Lus10030695 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G29240 85 / 2e-20 Protein of unknown function (DUF179) (.1), Protein of unknown function (DUF179) (.2)
AT1G33780 50 / 6e-08 Protein of unknown function (DUF179) (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005224 164 / 2e-51 AT3G29240 291 / 2e-98 Protein of unknown function (DUF179) (.1), Protein of unknown function (DUF179) (.2)
Lus10001286 61 / 7e-12 AT1G33780 386 / 9e-135 Protein of unknown function (DUF179) (.1)
Lus10009463 61 / 1e-11 AT1G33780 379 / 6e-132 Protein of unknown function (DUF179) (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G125800 104 / 6e-28 AT3G29240 358 / 3e-124 Protein of unknown function (DUF179) (.1), Protein of unknown function (DUF179) (.2)
Potri.019G073000 61 / 1e-11 AT1G33780 349 / 4e-120 Protein of unknown function (DUF179) (.1)
Potri.013G100000 59 / 6e-11 AT1G33780 385 / 3e-134 Protein of unknown function (DUF179) (.1)
PFAM info
Representative CDS sequence
>Lus10030695 pacid=23155212 polypeptide=Lus10030695 locus=Lus10030695.g ID=Lus10030695.BGIv1.0 annot-version=v1.0
ATGGAAGCTAACTGCTTTCTCACTTCACCCAATCCCTTCCCCAAATCATCTGCAAAACCACCGCCCGCCGGAGCTCCCAAGAGAATCCGCCTTGCCCCAT
CAATTACATGTTGTCAAATTTCGGAATCATCCGGTGAGCACAACCGATCCTTCCTGGACGCCGACTGGAGATGGTTCAGAGCAAGACTCTTAGCCAACGA
GCAATCCTTGATCACCGGAGGATCCACGGCGGCGGATCATCATCCCAAAGCTAAACCACCACCGTTGGTGACAGTAGGGGACAGATGGGCCCACGCGATC
CACGATCCGGAAAAGGGCTGCCTACTCATAGCTACGGAGAAGCTGGACGGGGTCCACATCTTCGAACGACAGTCATCCTCATCCTGTCAACGGGCCCATT
AG
AA sequence
>Lus10030695 pacid=23155212 polypeptide=Lus10030695 locus=Lus10030695.g ID=Lus10030695.BGIv1.0 annot-version=v1.0
MEANCFLTSPNPFPKSSAKPPPAGAPKRIRLAPSITCCQISESSGEHNRSFLDADWRWFRARLLANEQSLITGGSTAADHHPKAKPPPLVTVGDRWAHAI
HDPEKGCLLIATEKLDGVHIFERQSSSSCQRAH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G29240 Protein of unknown function (D... Lus10030695 0 1
AT1G13890 ATSNAP30, SNAP3... soluble N-ethylmaleimide-sensi... Lus10004660 1.7 0.7414
Lus10029488 6.7 0.6720
AT1G08500 AtENODL18 early nodulin-like protein 18 ... Lus10009231 18.9 0.6574
AT5G52780 Protein of unknown function (D... Lus10038849 20.1 0.7115
AT4G28940 Phosphorylase superfamily prot... Lus10023668 29.3 0.6983
AT3G12660 FLA14 FASCICLIN-like arabinogalactan... Lus10041630 30.0 0.6480
AT4G02610 Aldolase-type TIM barrel famil... Lus10014725 31.2 0.5907
AT1G03700 Uncharacterised protein family... Lus10032548 31.7 0.6560
AT1G13890 ATSNAP30, SNAP3... soluble N-ethylmaleimide-sensi... Lus10037092 35.5 0.6291
AT1G20693 HMGBETA1, NFD2,... NUCLEOSOME/CHROMATIN ASSEMBLY ... Lus10016025 38.7 0.6616

Lus10030695 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.