Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G15460 152 / 4e-49 MUB2 membrane-anchored ubiquitin-fold protein 2 (.1.2) AT3G01050 150 / 1e-48 MUB1 membrane-anchored ubiquitin-fold protein 1 precursor (.1) AT1G22050 129 / 2e-40 MUB6 membrane-anchored ubiquitin-fold protein 6 precursor (.1) AT1G77870 119 / 4e-36 MUB5 membrane-anchored ubiquitin-fold protein 5 precursor (.1) AT3G26980 108 / 6e-32 MUB4 membrane-anchored ubiquitin-fold protein 4 precursor (.1) AT4G24990 108 / 7e-32 ATGP4 Ubiquitin family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013190 [exp] 206 / 2e-70 AT5G15460 150 / 8e-48 membrane-anchored ubiquitin-fold protein 2 (.1.2) Lus10035184 [exp] 120 / 1e-36 AT3G26980 178 / 3e-59 membrane-anchored ubiquitin-fold protein 4 precursor (.1) Lus10032014 [exp] 119 / 3e-36 AT3G26980 174 / 9e-58 membrane-anchored ubiquitin-fold protein 4 precursor (.1) Lus10041539 [exp] 118 / 2e-35 AT3G26980 168 / 4e-55 membrane-anchored ubiquitin-fold protein 4 precursor (.1) Lus10012555 [exp] 119 / 2e-32 AT5G13990 608 / 0.0 exocyst subunit exo70 family protein C2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G090700 [exp] 185 / 2e-62 AT3G01050 157 / 7e-51 membrane-anchored ubiquitin-fold protein 1 precursor (.1) Potri.004G124600 [exp] 180 / 3e-60 AT3G01050 155 / 2e-50 membrane-anchored ubiquitin-fold protein 1 precursor (.1) Potri.002G091800 [exp] 122 / 3e-37 AT1G22050 124 / 5e-38 membrane-anchored ubiquitin-fold protein 6 precursor (.1) Potri.001G325900 [exp] 118 / 6e-36 AT3G26980 169 / 7e-56 membrane-anchored ubiquitin-fold protein 4 precursor (.1) Potri.017G068100 [exp] 110 / 9e-33 AT3G26980 154 / 1e-49 membrane-anchored ubiquitin-fold protein 4 precursor (.1) Potri.015G101200 [exp] 104 / 2e-30 AT4G24990 197 / 6e-67 Ubiquitin family protein (.1) Potri.012G103100 [exp] 104 / 2e-30 AT4G24990 207 / 5e-71 Ubiquitin family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10030704 pacid=23155382 polypeptide=Lus10030704 locus=Lus10030704.g ID=Lus10030704.BGIv1.0 annot-version=v1.0 ATGGCCGGGGTACAAGATCAGTTAGAGATCAAATTTCGGTTGACTGATGGAACAGATATTGGCCCCAAAAGCTTTCCTTGTGCTGCGAGTGTTGCAACTT TGAAGGAGACCATTCTTGCTCAATGGCCTAAAGAAAAAGAGAACGGTCCAAGGACGGTGAAAGATGTGAAGTTGATAAGCGCAGGAAGGATATTGGAGAA CAGTAGAACCGTAGGCGAATGTCGCAGCCCCCTATGTGATGTTCCTGGTGGGGTTACAACCATGCACGTTGTTGTTCAACCACCATCTACGGAGAAAGGT ACAATTCTGTTCTAA
AA sequence Show only first row Show all	>Lus10030704 pacid=23155382 polypeptide=Lus10030704 locus=Lus10030704.g ID=Lus10030704.BGIv1.0 annot-version=v1.0 MAGVQDQLEIKFRLTDGTDIGPKSFPCAASVATLKETILAQWPKEKENGPRTVKDVKLISAGRILENSRTVGECRSPLCDVPGGVTTMHVVVQPPSTEKG TILF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G15460		MUB2	membrane-anchored ubiquitin-fo...		Lus10030704 [exp]	0	1
AT4G30830			Protein of unknown function, D...		Lus10036599 [exp]	1.0	0.9055
AT2G25070			Protein phosphatase 2C family ...		Lus10026253 [exp]	2.4	0.8891
AT1G55680			Transducin/WD40 repeat-like su...		Lus10037252 [exp]	4.7	0.9052
AT4G21760		BGLU47	beta-glucosidase 47 (.1)		Lus10000225 [exp]	10.0	0.8603
AT1G28490		OSM1, ATSYP61, ...	syntaxin of plants 61 (.1.2)		Lus10017686 [exp]	16.5	0.8833
AT1G78680		ATGGH2	gamma-glutamyl hydrolase 2 (.1...		Lus10042847 [exp]	17.5	0.8607
AT1G65320			Cystathionine beta-synthase (C...		Lus10011457 [exp]	19.1	0.8548
AT5G50430		UBC33	ubiquitin-conjugating enzyme 3...		Lus10037459 [exp]	20.0	0.8573
AT3G18820		RAB71, AtRABG3f...	RAB GTPase homolog G3F (.1)		Lus10042328 [exp]	20.2	0.8779
AT1G34750			Protein phosphatase 2C family ...		Lus10020924 [exp]	21.2	0.8726

Compare expression of checked genes

Lus10030704 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.