Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013206 [exp] 77 / 5e-21 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G255701 [exp] 50 / 3e-10 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10030724 pacid=23155219 polypeptide=Lus10030724 locus=Lus10030724.g ID=Lus10030724.BGIv1.0 annot-version=v1.0 ATGTCGTTCATGAGGGGAGAGCCTTTGTTTTCCAAGCTGTCAGCTCTGTCTCAATACGTGGTTTTTCCGGGAGCCATGATCGCCGCTCTCATCTATTCCC CGCCGCGCTACGGATCCTCGTCTTCCTCCTCCTCATCCTCCAACACCTCCAGTTCCTCTAAATAG
AA sequence Show only first row Show all	>Lus10030724 pacid=23155219 polypeptide=Lus10030724 locus=Lus10030724.g ID=Lus10030724.BGIv1.0 annot-version=v1.0 MSFMRGEPLFSKLSALSQYVVFPGAMIAALIYSPPRYGSSSSSSSSSNTSSSSK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10030724 [exp]	0	1
					Lus10034993 [exp]	2.2	0.8739
AT2G31490			unknown protein		Lus10027603 [exp]	2.8	0.8477
AT3G05070			unknown protein		Lus10042290 [exp]	4.9	0.8340
AT1G05205			unknown protein		Lus10027173 [exp]	7.9	0.8518
					Lus10006375 [exp]	14.9	0.7764
AT1G49410		TOM6	translocase of the outer mitoc...		Lus10007383 [exp]	18.5	0.8542
AT4G11410			NAD(P)-binding Rossmann-fold s...		Lus10032280 [exp]	33.5	0.8460
AT4G21970			Protein of unknown function, D...		Lus10006781 [exp]	36.9	0.7471
AT1G72610		ATGER1, GLP1	A. THALIANA GERMIN-LIKE PROTEI...		Lus10037666 [exp]	45.8	0.8323
AT5G48385			FRIGIDA-like protein (.1)		Lus10004131 [exp]	48.3	0.7045

Compare expression of checked genes

Lus10030724 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.