Lus10030725 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G24830 194 / 7e-61 arginosuccinate synthase family (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013207 216 / 1e-69 AT4G24830 724 / 0.0 arginosuccinate synthase family (.1.2)
Lus10012800 209 / 1e-66 AT4G24830 777 / 0.0 arginosuccinate synthase family (.1.2)
Lus10033978 204 / 1e-64 AT4G24830 767 / 0.0 arginosuccinate synthase family (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G020200 204 / 2e-64 AT4G24830 761 / 0.0 arginosuccinate synthase family (.1.2)
Potri.010G239000 203 / 3e-64 AT4G24830 754 / 0.0 arginosuccinate synthase family (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0039 HUP PF00764 Arginosuc_synth Arginosuccinate synthase
Representative CDS sequence
>Lus10030725 pacid=23155380 polypeptide=Lus10030725 locus=Lus10030725.g ID=Lus10030725.BGIv1.0 annot-version=v1.0
ATGAACCAGTTGAAGGCGCAATCCGCCAGCCTCACCTCCGACGGAGGACTCCGGCGAGGGAGAATTATGGCTGTGAGGTTGTCTGCTTTACTGCTGATGT
TGGTCAAGGAGACGATCCAAGTGAAAGACTCGCTAGCGTTGAAGTACGCGGAGCTGGTTTATGCCGGTAGGTGGTTTGATCCACTTCGCGAATCGATGGA
CGCATTCATGGAGAAGATCACGGAAACAACTACCGGTTGTGTGACTCTGAAGCTTTACAAGGGATCCGTTTCAGTAGCGGGGAGAACGAGTCCGAATAGT
CTGTACAGGGAAGACATTGCGTCGTTTGAGAACGGGGAGATATATGATCAAGCTGATGCTGCTGGGTTTATTAGGTTGTACGGTCTTCCCATGAGAGTTA
GGGCAATGCTTGAAAAGGGTATCTGA
AA sequence
>Lus10030725 pacid=23155380 polypeptide=Lus10030725 locus=Lus10030725.g ID=Lus10030725.BGIv1.0 annot-version=v1.0
MNQLKAQSASLTSDGGLRRGRIMAVRLSALLLMLVKETIQVKDSLALKYAELVYAGRWFDPLRESMDAFMEKITETTTGCVTLKLYKGSVSVAGRTSPNS
LYREDIASFENGEIYDQADAAGFIRLYGLPMRVRAMLEKGI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G24830 arginosuccinate synthase famil... Lus10030725 0 1
AT1G80480 PTAC17 plastid transcriptionally acti... Lus10018172 3.2 0.8620
AT1G14810 semialdehyde dehydrogenase fam... Lus10013239 9.5 0.7981
AT3G51010 unknown protein Lus10042347 10.8 0.8645
AT5G43790 Pentatricopeptide repeat (PPR)... Lus10039388 15.6 0.8567
AT1G63270 ABCI1, ATNAP10 ATP-binding cassette I1, non-i... Lus10022692 17.3 0.8377
AT5G66500 Tetratricopeptide repeat (TPR)... Lus10041770 17.7 0.8256
AT4G10760 MTA, EMB1706 EMBRYO DEFECTIVE 1706, mRNAade... Lus10010408 18.8 0.8398
AT2G28190 CZSOD2, CSD2 copper/zinc superoxide dismuta... Lus10016155 18.9 0.8230
AT1G05670 Pentatricopeptide repeat (PPR-... Lus10026465 19.9 0.8264
AT2G03880 REME1 required for efficiency of mit... Lus10001617 20.2 0.8478

Lus10030725 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.