Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030775 [exp] 134 / 2e-41 ND / Lus10030783 [exp] 82 / 3e-21 ND 35 / 0.009 Lus10030777 [exp] 70 / 6e-16 AT5G48540 39 / 8e-04 receptor-like protein kinase-related family protein (.1) Lus10034545 [exp] 65 / 4e-14 ND / Lus10030781 [exp] 63 / 1e-13 ND / Lus10030780 [exp] 63 / 3e-13 ND 36 / 0.004 Lus10030779 [exp] 62 / 4e-13 AT1G70690 36 / 0.005 PLASMODESMATA-LOCATED PROTEIN 5, HOPW1-1-INDUCED GENE1, Receptor-like protein kinase-related family protein (.1) Lus10032027 [exp] 60 / 2e-12 ND / Lus10030778 [exp] 60 / 3e-12 AT5G37660 37 / 0.002 plasmodesmata-located protein 7 (.1.2)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10030774 pacid=23155303 polypeptide=Lus10030774 locus=Lus10030774.g ID=Lus10030774.BGIv1.0 annot-version=v1.0 ATGACTGCAATAACGATAACATTACTGATTGCTATTGTCATTGCTGCCGAGGAGGAGCCTCGAGGTTGCGGCAAGGCGGGACCGGTGGACACCGGGGAGT GCAAAGGCACGTATCTCTACTGCGTAACGGAATTGATAACTGCGTTAATTGCAACAGCACCCTACACCAGCACAGACTACATCTTGAGGCAGACTTACCC AACACAAGGCAACCCATCTGGCGGCGTTCGTGGTGAAGCGATCTGCGTTGCTGGTGACTATGATGGCGGGTGCAAGAACTGTCTTCTTGGCATCAAAGAG ACACTGAGCTACTATTGCTATAACTTTGAAGGCGGCTTCTTCTACAATCACTATTGCTCCATCAAATACCACCAAATGTTTGTAAACTGA
AA sequence Show only first row Show all	>Lus10030774 pacid=23155303 polypeptide=Lus10030774 locus=Lus10030774.g ID=Lus10030774.BGIv1.0 annot-version=v1.0 MTAITITLLIAIVIAAEEEPRGCGKAGPVDTGECKGTYLYCVTELITALIATAPYTSTDYILRQTYPTQGNPSGGVRGEAICVAGDYDGGCKNCLLGIKE TLSYYCYNFEGGFFYNHYCSIKYHQMFVN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10030774 [exp]	0	1
AT5G23960		ATTPS21	terpene synthase 21 (.1.2)		Lus10008614 [exp]	1.0	0.9773
AT4G37390		AUR3, YDK1, GH3...	YADOKARI 1, AUXIN UPREGULATED ...		Lus10014869 [exp]	2.0	0.9559
AT5G38200			Class I glutamine amidotransfe...		Lus10016700 [exp]	7.9	0.9191
AT2G24610		ATCNGC14	cyclic nucleotide-gated channe...		Lus10020122 [exp]	8.2	0.9334
AT1G21326			VQ motif-containing protein (....		Lus10012286 [exp]	8.4	0.9679
AT2G27410	B3		Domain of unknown function (DU...		Lus10027286 [exp]	9.2	0.9461
AT2G29100		ATGLR2.9	GLUTAMATE RECEPTOR 2.9, gluta...		Lus10025427 [exp]	9.4	0.9476
AT1G17860			Kunitz family trypsin and prot...		Lus10030354 [exp]	9.8	0.9377
AT2G29070			Ubiquitin fusion degradation U...		Lus10029298 [exp]	10.4	0.9474
AT1G47710			Serine protease inhibitor (SER...		Lus10019009 [exp]	12.6	0.9305

Compare expression of checked genes

Lus10030774 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.