Lus10030775 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030774 139 / 5e-43 ND /
Lus10030783 81 / 3e-20 ND 35 / 0.009
Lus10030779 74 / 3e-17 AT1G70690 36 / 0.005 PLASMODESMATA-LOCATED PROTEIN 5, HOPW1-1-INDUCED GENE1, Receptor-like protein kinase-related family protein (.1)
Lus10030777 70 / 8e-16 AT5G48540 39 / 8e-04 receptor-like protein kinase-related family protein (.1)
Lus10001790 69 / 1e-15 ND /
Lus10030778 66 / 2e-14 AT5G37660 37 / 0.002 plasmodesmata-located protein 7 (.1.2)
Lus10034545 65 / 4e-14 ND /
Lus10034546 64 / 2e-13 AT3G22060 43 / 1e-05 Receptor-like protein kinase-related family protein (.1)
Lus10013257 64 / 2e-13 AT4G23300 51 / 3e-08 cysteine-rich RLK (RECEPTOR-like protein kinase) 22 (.1)
Poplar homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01657 Stress-antifung Salt stress response/antifungal
Representative CDS sequence
>Lus10030775 pacid=23155347 polypeptide=Lus10030775 locus=Lus10030775.g ID=Lus10030775.BGIv1.0 annot-version=v1.0
ATGGACTACTACTACTGCTACTGCTCTTCTTCTTCTTCTTCTTCTTTCAGTAAGAAACTCATGAAAATTGCAATAATAACATTGCTGCTTATTATTACTA
GCACCACCTTTGTCGCCGGAGAACAGCCTCAAGGTTGTAGCAAGACGGGACCGGTGGACAGCGGGCCATGTAAAGGCACCTATCTCGATTGTGTAACGGT
ATTGCTCAATGCGTTCATTGATGGCGCACCCGAGACTAGTACAGGCTATACGTCATTGCTGTATTATCCTGATGGAAACCCCTCTGGCGGAGTTACTGGT
ACAGCGATATGCGTCCTTGGCTCCTACAGCGCCGGCTGTCGGAACTGTCTTCGTGGCATCAGAGAGACACTAAACTACTATTGCTCTGCGTCTGAAGGCG
GCTACTTCTACACCCAGTACTGCTCCATCGAATACCATCAAATCCCCTGA
AA sequence
>Lus10030775 pacid=23155347 polypeptide=Lus10030775 locus=Lus10030775.g ID=Lus10030775.BGIv1.0 annot-version=v1.0
MDYYYCYCSSSSSSSFSKKLMKIAIITLLLIITSTTFVAGEQPQGCSKTGPVDSGPCKGTYLDCVTVLLNAFIDGAPETSTGYTSLLYYPDGNPSGGVTG
TAICVLGSYSAGCRNCLRGIRETLNYYCSASEGGYFYTQYCSIEYHQIP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10030775 0 1
AT1G29010 unknown protein Lus10013977 11.7 0.8145
AT2G16630 Pollen Ole e 1 allergen and ex... Lus10042394 14.0 0.8140
AT2G46200 unknown protein Lus10021211 19.5 0.8132
Lus10041330 21.6 0.6900
AT2G23110 Late embryogenesis abundant pr... Lus10029709 25.7 0.8120
AT5G55050 GDSL-like Lipase/Acylhydrolase... Lus10025104 26.5 0.8115
AT1G34580 Major facilitator superfamily ... Lus10020934 26.8 0.7067
AT5G07050 nodulin MtN21 /EamA-like trans... Lus10041634 30.9 0.8078
AT3G18590 AtENODL5 early nodulin-like protein 5 (... Lus10009617 32.1 0.8031
AT2G16630 Pollen Ole e 1 allergen and ex... Lus10026279 34.7 0.8046

Lus10030775 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.