Lus10030777 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034545 151 / 4e-48 ND /
Lus10030780 134 / 3e-41 ND 36 / 0.004
Lus10030781 130 / 6e-40 ND /
Lus10013255 127 / 1e-38 ND /
Lus10035197 115 / 6e-34 ND /
Lus10034546 115 / 6e-34 AT3G22060 43 / 1e-05 Receptor-like protein kinase-related family protein (.1)
Lus10013254 109 / 2e-31 ND /
Lus10032027 108 / 3e-31 ND /
Lus10013256 99 / 2e-26 AT3G21970 39 / 8e-04 Domain of unknown function (DUF26) (.1)
Poplar homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01657 Stress-antifung Salt stress response/antifungal
Representative CDS sequence
>Lus10030777 pacid=23155228 polypeptide=Lus10030777 locus=Lus10030777.g ID=Lus10030777.BGIv1.0 annot-version=v1.0
ATGCCTTCTTCTTCTTCTTCTTATCTGAGTAAGAAACTCGTGGCGATAACGATGCAGCTGCTAATGACTGTCGCGGTTACCGTTTCGGAGGAATCTCGCT
GCAGCCTGGCGGGGCCGGTAGCAATAGGGCCTTGTAAAGACGACTATGCCCTTTGCGTAGACAACGTCGTCACAGTGTTGAGAGACACGACTCCCCACTC
TGAAGACGGGTTAGTCACAACGTTTTACCCAGCTGACCAGCCATATAGCGGTGTTTATGGCACCGCGGCGTGTGGTGCTCAATCTACCTTCAGTGGCTGC
CTGAGCTGCCTTTCGGACGCCAAAGACTGGCTGGACCAGAACTGCGCTGGTTTCTCCGGTGGTTACTACCTGTACGATACGTATTGTGCCATGACGTACG
AGCAAGTATTTGATGATAATTAA
AA sequence
>Lus10030777 pacid=23155228 polypeptide=Lus10030777 locus=Lus10030777.g ID=Lus10030777.BGIv1.0 annot-version=v1.0
MPSSSSSYLSKKLVAITMQLLMTVAVTVSEESRCSLAGPVAIGPCKDDYALCVDNVVTVLRDTTPHSEDGLVTTFYPADQPYSGVYGTAACGAQSTFSGC
LSCLSDAKDWLDQNCAGFSGGYYLYDTYCAMTYEQVFDDN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G48540 receptor-like protein kinase-r... Lus10030777 0 1
AT3G18040 ATMPK9 MAP kinase 9 (.1.2) Lus10038956 2.0 1.0000
AT5G52605 Defensin-like (DEFL) family pr... Lus10031095 3.7 1.0000
AT1G21000 PLATZ transcription factor fam... Lus10005350 4.6 1.0000
AT5G56670 Ribosomal protein S30 family p... Lus10019054 5.3 1.0000
Lus10035508 5.9 1.0000
AT5G44950 F-box/RNI-like/FBD-like domain... Lus10018863 6.0 0.8221
Lus10012269 6.5 1.0000
Lus10034814 6.9 0.9390
AT5G04347 Plant self-incompatibility pro... Lus10029375 7.0 1.0000
AT4G16640 Matrixin family protein (.1) Lus10037419 7.1 0.9815

Lus10030777 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.