Lus10030779 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030778 145 / 6e-46 AT5G37660 37 / 0.002 plasmodesmata-located protein 7 (.1.2)
Lus10034546 96 / 2e-26 AT3G22060 43 / 1e-05 Receptor-like protein kinase-related family protein (.1)
Lus10013254 94 / 2e-25 ND /
Lus10013255 92 / 2e-24 ND /
Lus10035197 88 / 4e-23 ND /
Lus10032027 85 / 6e-22 ND /
Lus10034545 82 / 9e-21 ND /
Lus10030781 81 / 3e-20 ND /
Lus10030777 80 / 7e-20 AT5G48540 39 / 8e-04 receptor-like protein kinase-related family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G130800 43 / 2e-05 AT5G37660 314 / 1e-107 plasmodesmata-located protein 7 (.1.2)
Potri.004G086000 40 / 0.0003 AT5G37660 301 / 1e-102 plasmodesmata-located protein 7 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01657 Stress-antifung Salt stress response/antifungal
Representative CDS sequence
>Lus10030779 pacid=23155243 polypeptide=Lus10030779 locus=Lus10030779.g ID=Lus10030779.BGIv1.0 annot-version=v1.0
ATGGCTTCTTCTTCTTCTTCGACGATAACCATATTTCTTCTGATCATGATCGTCACTGTTTCCGTTGACTACTCTTCCGCCGACGACGTCACTACATGCG
GCAAGGTAGGGCCGGTAGCTCAGGGTGCTTGTAATGGCTTCTACGGTTATTGTGTGACCAACGTGCTGACGGCCTTAAGAGACGTGACCCCATCCATGGG
AAACACCGTTTACTCCCGTTCCTTCCCACCGAACGGCGAGAAAGGCGGCGTTACGGGTACCGCGGATTGCGTATATCCGAACAGCGTCAACACGTGCCAG
GATTGCCTCCGTGAAGCCAAGAAGTGGCTGGACTCTTCGTGTGCTGCTTCTGATTCCGGCACCTACGTTACAAGTGTTTGTATGATGTATTACAGCCAGA
TCCCCAACTAA
AA sequence
>Lus10030779 pacid=23155243 polypeptide=Lus10030779 locus=Lus10030779.g ID=Lus10030779.BGIv1.0 annot-version=v1.0
MASSSSSTITIFLLIMIVTVSVDYSSADDVTTCGKVGPVAQGACNGFYGYCVTNVLTALRDVTPSMGNTVYSRSFPPNGEKGGVTGTADCVYPNSVNTCQ
DCLREAKKWLDSSCAASDSGTYVTSVCMMYYSQIPN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G70690 HWI1, PDLP5 PLASMODESMATA-LOCATED PROTEIN ... Lus10030779 0 1
AT5G51160 Ankyrin repeat family protein ... Lus10034255 1.0 0.9046
AT1G79460 ATKS1, ATKS, GA... GA REQUIRING 2, ARABIDOPSIS TH... Lus10012880 6.3 0.8043
AT3G57240 BG3 "beta-1,3-glucanase 3", beta-1... Lus10002807 6.9 0.7370
AT2G36760 UGT73C2 UDP-glucosyl transferase 73C2 ... Lus10014404 17.1 0.6702
AT2G47540 Pollen Ole e 1 allergen and ex... Lus10008213 18.6 0.6995
AT4G37530 Peroxidase superfamily protein... Lus10011079 28.0 0.7854
AT1G14600 GARP Homeodomain-like superfamily p... Lus10029808 33.0 0.6969
Lus10029807 37.8 0.7694
AT1G32730 unknown protein Lus10000258 39.3 0.6700
AT3G23240 AP2_ERF ERF1, ATERF1 ethylene response factor 1 (.1... Lus10021193 43.5 0.7572

Lus10030779 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.