Lus10030781 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034545 142 / 6e-45 ND /
Lus10030780 120 / 6e-36 ND 36 / 0.004
Lus10030777 117 / 1e-34 AT5G48540 39 / 8e-04 receptor-like protein kinase-related family protein (.1)
Lus10034546 97 / 5e-27 AT3G22060 43 / 1e-05 Receptor-like protein kinase-related family protein (.1)
Lus10013255 93 / 5e-25 ND /
Lus10032027 91 / 2e-24 ND /
Lus10013256 91 / 8e-24 AT3G21970 39 / 8e-04 Domain of unknown function (DUF26) (.1)
Lus10035197 87 / 5e-23 ND /
Lus10013254 84 / 1e-21 ND /
Poplar homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01657 Stress-antifung Salt stress response/antifungal
Representative CDS sequence
>Lus10030781 pacid=23155351 polypeptide=Lus10030781 locus=Lus10030781.g ID=Lus10030781.BGIv1.0 annot-version=v1.0
ATGGCAATAACGATGCTGCTCCTGCTTATAGTCACAACTGCCATTGCCCTCCAAACTGGTTGCAGCCCGGCGGGGCCGATACAATCAGGGCCTTGTAAAG
ACGACTATTCCCTTTGTGTTGCCAACGTGATCACAGTGTTGAGAGACAGGACTCCCTACGAGGGGTCATTCTCCACGTATTACCCCGCTGATGACCAACC
TGCATCTGGCGGCGTTTCGGGTAACGCTGATTGCAGTCCTGAATCTACCTTCAATGATTGTCGGAGCTGCCTTATCGCCGCCAAAGACTGGCTCGACCAG
AATTGCGTTGGTTTCGCCGGTGGTAACTACTCCGGTCAGGGGAATAATTGTTTCATGATGTACGGCCAAGCCTTTGGTTAA
AA sequence
>Lus10030781 pacid=23155351 polypeptide=Lus10030781 locus=Lus10030781.g ID=Lus10030781.BGIv1.0 annot-version=v1.0
MAITMLLLLIVTTAIALQTGCSPAGPIQSGPCKDDYSLCVANVITVLRDRTPYEGSFSTYYPADDQPASGGVSGNADCSPESTFNDCRSCLIAAKDWLDQ
NCVGFAGGNYSGQGNNCFMMYGQAFG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10030781 0 1

Lus10030781 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.