Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013257 [exp] 83 / 3e-21 AT4G23300 51 / 3e-08 cysteine-rich RLK (RECEPTOR-like protein kinase) 22 (.1) Lus10035197 [exp] 72 / 6e-17 ND / Lus10032027 [exp] 71 / 9e-17 ND / Lus10030780 [exp] 67 / 5e-15 ND 36 / 0.004 Lus10030781 [exp] 65 / 2e-14 ND / Lus10034545 [exp] 65 / 3e-14 ND / Lus10001790 [exp] 64 / 1e-13 ND / Lus10030777 [exp] 62 / 4e-13 AT5G48540 39 / 8e-04 receptor-like protein kinase-related family protein (.1) Lus10030783 [exp] 62 / 4e-13 ND 35 / 0.009
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10030782 pacid=23155200 polypeptide=Lus10030782 locus=Lus10030782.g ID=Lus10030782.BGIv1.0 annot-version=v1.0 ATGGCAATAATAATAACAATGCTGCTGATGGTAACTACTGTCACGGCTGTTACCGACCAGCAAGTTTGCGGTGCATATCAGCCGGTAGCTTCGGGGCCTT GTACGGAGGACTACGCCGATTGTGTAAAAAATGTGATCACGGCGTTACAGACGCGGACTGCCGGAAAAGATTACTACTTGTCGACGTCTTCCCCGGAGGG CTACCCAATTGGCGGAGTTAAGGGTGAGGCGACTTGCATTTTGTCATCGGGTGTGGAGGACTGCAAGAGCTGCCTTGAATACGCCAAAGGGTGGCTAGCC AATAATTGCGGCGGCGTTAGTAGCGGATATTACTCTTACGGTGTCTGCTCCATGTCTTACCAGCAAATCTCCTAA
AA sequence Show only first row Show all	>Lus10030782 pacid=23155200 polypeptide=Lus10030782 locus=Lus10030782.g ID=Lus10030782.BGIv1.0 annot-version=v1.0 MAIIITMLLMVTTVTAVTDQQVCGAYQPVASGPCTEDYADCVKNVITALQTRTAGKDYYLSTSSPEGYPIGGVKGEATCILSSGVEDCKSCLEYAKGWLA NNCGGVSSGYYSYGVCSMSYQQIS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10030782 [exp]	0	1
					Lus10013881 [exp]	2.4	0.9474
AT1G22400		ATUGT85A1, UGT8...	ARABIDOPSIS THALIANA UDP-GLUCO...		Lus10013920 [exp]	4.2	0.9466
AT4G03170	B3		AP2/B3-like transcriptional fa...		Lus10043234 [exp]	4.4	0.7261
AT3G07120			RING/U-box superfamily protein...		Lus10038180 [exp]	5.1	0.8570
AT2G16730		BGAL13	beta-galactosidase 13, glycosy...		Lus10014126 [exp]	5.2	0.9466
AT5G45670			GDSL-like Lipase/Acylhydrolase...		Lus10015241 [exp]	6.0	0.9466
AT5G20260			Exostosin family protein (.1)		Lus10039980 [exp]	6.7	0.9466
AT1G22380		ATUGT85A3	UDP-glucosyl transferase 85A3 ...		Lus10013919 [exp]	7.3	0.9329
AT1G26730			EXS (ERD1/XPR1/SYG1) family pr...		Lus10004284 [exp]	7.9	0.9327
AT1G18010			Major facilitator superfamily ...		Lus10009413 [exp]	8.5	0.9202

Compare expression of checked genes

Lus10030782 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.