Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034545 [exp] 89 / 8e-24 ND / Lus10030774 [exp] 87 / 6e-23 ND / Lus10030781 [exp] 84 / 1e-21 ND / Lus10030782 [exp] 81 / 6e-21 ND 39 / 4e-04 Lus10001790 [exp] 81 / 1e-20 ND / Lus10030777 [exp] 81 / 2e-20 AT5G48540 39 / 8e-04 receptor-like protein kinase-related family protein (.1) Lus10030775 [exp] 81 / 2e-20 ND / Lus10034546 [exp] 80 / 3e-20 AT3G22060 43 / 1e-05 Receptor-like protein kinase-related family protein (.1) Lus10032027 [exp] 76 / 1e-18 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G023700 [exp] 40 / 0.0001 AT4G05200 474 / 3e-159 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Potri.005G208400 [exp] 39 / 0.0002 AT5G48540 52 / 1e-08 receptor-like protein kinase-related family protein (.1) Potri.004G024000 [exp] 39 / 0.0004 AT4G23180 489 / 4e-165 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10030783 pacid=23155257 polypeptide=Lus10030783 locus=Lus10030783.g ID=Lus10030783.BGIv1.0 annot-version=v1.0 ATGGCGGTGGCCGTCGTTTCGAGGGAGCTGCGTCCTTTCTGCTACTGGAGAAAGCCAGTGGCTGCCGGTCCTTGCAAACACCACTACCTCTACTGTGTGA CGGAAGTGATCACGGCGTTAATTGAGCATACGCCCTATAATTCAGTCTTCGAGTCAGTCAAGTCTTACCCACTACCAGAAGTCTCTGGCGGCGTTAGAGG TCACGCTACCTGCGATGCTAGTATTACAATTGATGAATGCCGGAACTGCCTTCTCACCGCCAAAGAGTGGCTGAATTGGTATTGCTCTTCAGGTCGAGGA GGCTACTACTCTCTCAACGGCTGTTCATTGTCTTACCGTCAAGTCGCCTAA
AA sequence Show only first row Show all	>Lus10030783 pacid=23155257 polypeptide=Lus10030783 locus=Lus10030783.g ID=Lus10030783.BGIv1.0 annot-version=v1.0 MAVAVVSRELRPFCYWRKPVAAGPCKHHYLYCVTEVITALIEHTPYNSVFESVKSYPLPEVSGGVRGHATCDASITIDECRNCLLTAKEWLNWYCSSGRG GYYSLNGCSLSYRQVA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10030783 [exp]	0	1
AT2G22180			hydroxyproline-rich glycoprote...		Lus10000688 [exp]	2.4	1.0000
					Lus10000824 [exp]	3.5	1.0000
AT2G33470		ATGLTP1, GLTP1	ARABIDOPSIS GLYCOLIPID TRANSFE...		Lus10003626 [exp]	4.9	1.0000
					Lus10011629 [exp]	6.0	1.0000
					Lus10003272 [exp]	6.0	1.0000
AT5G26150			protein kinase family protein ...		Lus10024998 [exp]	7.3	1.0000
					Lus10010826 [exp]	7.7	1.0000
AT1G11040			HSP40/DnaJ peptide-binding pro...		Lus10025682 [exp]	7.7	1.0000
					Lus10029832 [exp]	8.5	1.0000
AT5G09280			Pectin lyase-like superfamily ...		Lus10031867 [exp]	8.8	1.0000

Compare expression of checked genes

Lus10030783 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.