Lus10030789 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013266 121 / 1e-36 ND /
Lus10020770 77 / 1e-17 AT1G06530 147 / 6e-42 peroxisomal and mitochondrial division factor 2, Tropomyosin-related (.1)
Lus10010937 72 / 8e-16 AT3G58840 140 / 3e-39 peroxisomal and mitochondrial division factor 1, Tropomyosin-related (.1.2)
Lus10031394 69 / 1e-14 AT1G06530 130 / 1e-35 peroxisomal and mitochondrial division factor 2, Tropomyosin-related (.1)
Lus10007347 48 / 2e-07 AT3G58840 148 / 3e-42 peroxisomal and mitochondrial division factor 1, Tropomyosin-related (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G060200 40 / 0.0002 AT1G06530 91 / 5e-21 peroxisomal and mitochondrial division factor 2, Tropomyosin-related (.1)
PFAM info
Representative CDS sequence
>Lus10030789 pacid=23155425 polypeptide=Lus10030789 locus=Lus10030789.g ID=Lus10030789.BGIv1.0 annot-version=v1.0
ATGGAGAAGAAAGCCGGAATGAGTACTGACAGAGATAAGGGGTTGGTTGAATACAAGAGGAGAGTGGAGGAATTGGAGGAGTTGGCTGTTAGATCTGAAA
CGGAGGGGAAGTTGATCGTCTCTGGAAAAAGGAACAGAGAGCTCGAAATGAAGATGGTGAAGTTACGGAAGAAGGCTGGGGAGGCTGAGAAGAGGGTCGT
TGAGATGAAACAGGCGGCTTTCGAAACCGTTGATAATGGCTTTGATGTTGAAGATGGTGAAGATAGAGATTTCAATGTGCAGTTGCCGGTTATGGTAATC
GTTGCAGCTGCAGTGGCCTGTCTCTTCTATGCAAGGAGTCAACGGAGAATTTATATCTCGAGAGCTTAG
AA sequence
>Lus10030789 pacid=23155425 polypeptide=Lus10030789 locus=Lus10030789.g ID=Lus10030789.BGIv1.0 annot-version=v1.0
MEKKAGMSTDRDKGLVEYKRRVEELEELAVRSETEGKLIVSGKRNRELEMKMVKLRKKAGEAEKRVVEMKQAAFETVDNGFDVEDGEDRDFNVQLPVMVI
VAAAVACLFYARSQRRIYISRA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10030789 0 1
AT2G20900 DGK5, ATDGK5 diacylglycerol kinase 5 (.1.2.... Lus10039747 2.0 0.8872
AT4G21390 B120 S-locus lectin protein kinase ... Lus10020083 5.5 0.9016
AT3G19184 B3 AP2/B3-like transcriptional fa... Lus10019872 15.7 0.8824
AT3G54670 ATSMC1, TTN8 TITAN8, STRUCTURAL MAINTENANCE... Lus10013583 17.1 0.7857
AT3G03080 Zinc-binding dehydrogenase fam... Lus10003638 20.2 0.8783
AT1G78570 ATRHM1, RHM1, R... REPRESSOR OF LRX1 1, ARABIDOPS... Lus10031389 21.8 0.7534
AT5G45180 Flavin-binding monooxygenase f... Lus10023942 22.1 0.7519
AT1G75750 GASA1 GAST1 protein homolog 1 (.1.2) Lus10034524 23.2 0.8770
AT5G04870 AK1, ATCPK1, CP... calcium dependent protein kina... Lus10029358 24.0 0.8769
AT3G52080 CHX28 cation/hydrogen exchanger 28 (... Lus10019716 24.5 0.8731

Lus10030789 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.