Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G39260 84 / 2e-20 binding;RNA binding (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023481 [exp] 122 / 1e-33 AT2G39260 1537 / 0.0 binding;RNA binding (.1) Lus10040364 [exp] 118 / 2e-32 AT2G39260 1620 / 0.0 binding;RNA binding (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G045400 [exp] 101 / 2e-26 AT2G39260 1375 / 0.0 binding;RNA binding (.1) Potri.010G216100 [exp] 97 / 5e-25 AT2G39260 1533 / 0.0 binding;RNA binding (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF04050 [flax] [poplar] Upf2 Up-frameshift suppressor 2
Representative CDS sequence Show only first row Show all	>Lus10030801 pacid=23155373 polypeptide=Lus10030801 locus=Lus10030801.g ID=Lus10030801.BGIv1.0 annot-version=v1.0 ATGGAGCAGCGGAGTCGACCAGCACTCAACATGGTAATACCGATGAACTTGTTTGAAGGATCGACCAAGGATCATCATGGAAGAGGGACTGGAGGTGAAA GTGGTGATGAGACATTGGACGAGGAAGCTGGAGGCGGCAAGGAGGTTAAGGTCAAAGTACTTGTTAAACGTGGTAACAAGCAACAGACGAAGCAGATGTA CATTCCTAGTGATTCATCTCTTGTCCAGAGCACTAAGCAAAAGGAAGCAGCGGAGGTTGAAGAGAAACAAGACGTCAAAAGGCGTGTCTTGGACTGA
AA sequence Show only first row Show all	>Lus10030801 pacid=23155373 polypeptide=Lus10030801 locus=Lus10030801.g ID=Lus10030801.BGIv1.0 annot-version=v1.0 MEQRSRPALNMVIPMNLFEGSTKDHHGRGTGGESGDETLDEEAGGGKEVKVKVLVKRGNKQQTKQMYIPSDSSLVQSTKQKEAAEVEEKQDVKRRVLD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G39260			binding;RNA binding (.1)		Lus10030801 [exp]	0	1
AT5G55500		ATXYLT	"beta-1,2-xylosyltransferase",...		Lus10014902 [exp]	1.0	0.9193
					Lus10017219 [exp]	2.8	0.8895
AT5G39960			GTP binding;GTP binding (.1)		Lus10033794 [exp]	3.2	0.8540
AT5G23540			Mov34/MPN/PAD-1 family protein...		Lus10011717 [exp]	3.5	0.8921
AT3G03980			NAD(P)-binding Rossmann-fold s...		Lus10002628 [exp]	3.7	0.8670
AT5G23540			Mov34/MPN/PAD-1 family protein...		Lus10011716 [exp]	4.2	0.8908
AT1G72890			Disease resistance protein (TI...		Lus10009384 [exp]	4.9	0.8509
AT1G65660		SMP1	SWELLMAP 1, Pre-mRNA splicing ...		Lus10007479 [exp]	5.0	0.8891
AT1G74920		ALDH10A8	aldehyde dehydrogenase 10A8 (....		Lus10004238 [exp]	5.1	0.8459
AT5G62810		ATPEX14, PED2, ...	PEROXISOME DEFECTIVE 2, peroxi...		Lus10039935 [exp]	5.5	0.8773

Compare expression of checked genes

Lus10030801 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.