Lus10030808 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G69935 75 / 7e-17 SHW1 short hypocotyl in white light1 (.1)
AT4G33780 68 / 3e-14 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013285 216 / 8e-72 AT1G69935 110 / 1e-30 short hypocotyl in white light1 (.1)
Lus10035665 73 / 9e-16 AT4G33780 157 / 2e-48 unknown protein
Lus10037250 58 / 4e-10 AT4G33780 150 / 9e-45 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G190900 102 / 4e-27 AT1G69935 91 / 1e-22 short hypocotyl in white light1 (.1)
Potri.001G289600 68 / 5e-14 AT4G33780 150 / 9e-46 unknown protein
PFAM info
Representative CDS sequence
>Lus10030808 pacid=23155225 polypeptide=Lus10030808 locus=Lus10030808.g ID=Lus10030808.BGIv1.0 annot-version=v1.0
ATGATGCTAAAGCTTGCAGCTCCGCTTCCCTCCCCATCCCTCCATCTCCGGCGATCCGCCGCAAATCTCCCCCGCCGCCCTCCAACCCTCTCCTCTTCTC
TCCTCCCCCACCGCAAAACCATTACAACCGTCATTTGCCACGGCAAGTTGGACGGCTTGTACGGAGAGAATCCAGACCCAGTTGAGAAGGGAACCGAAGC
TTTCTTTGAAGCGATTATGGGAGGAGGAATTGACGACGATGATGATGGATTTGATGATTATGATGGTGATGAAGAAGAAGAGACAGAGAGCAGTATCGAT
TTGTTCATCAGATTCTTGCAGAGCTCGCTGAAGAAAGTTTCCAGGCGTGCTAAAAGAGCTTCTCGCTCTGTTCTCCCTTCTGTCATCTCCCCACAATTGG
TTTCATTTGCGGTTGATGGGGTGCTGATTCTGACTGTACTCTTCATTTTCAAATCACTTCTTCAGGTGTTTTGCACCCTTGGAAGCACTGTTTTCGCCAC
GATACTGCTCGTTCAGGTTGTCTGGGCAGTGCTTTCCTACTTCCAATCGAATGGGAATGATGGCAGAAGATCCTCCTCTGGTACTAGACAGGCAGTAATA
TAA
AA sequence
>Lus10030808 pacid=23155225 polypeptide=Lus10030808 locus=Lus10030808.g ID=Lus10030808.BGIv1.0 annot-version=v1.0
MMLKLAAPLPSPSLHLRRSAANLPRRPPTLSSSLLPHRKTITTVICHGKLDGLYGENPDPVEKGTEAFFEAIMGGGIDDDDDGFDDYDGDEEEETESSID
LFIRFLQSSLKKVSRRAKRASRSVLPSVISPQLVSFAVDGVLILTVLFIFKSLLQVFCTLGSTVFATILLVQVVWAVLSYFQSNGNDGRRSSSGTRQAVI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G69935 SHW1 short hypocotyl in white light... Lus10030808 0 1
AT1G56180 unknown protein Lus10006532 5.2 0.8904
AT3G25410 Sodium Bile acid symporter fam... Lus10038237 9.7 0.8816
AT3G56650 Mog1/PsbP/DUF1795-like photosy... Lus10042812 13.6 0.8797
AT5G51545 LPA2 low psii accumulation2 (.1) Lus10031131 14.4 0.8739
AT5G51545 LPA2 low psii accumulation2 (.1) Lus10031710 14.8 0.8794
AT2G33800 EMB3113 EMBRYO DEFECTIVE 3113, Ribosom... Lus10015317 16.0 0.8786
AT1G76760 ATY1, TRX-Y1 thioredoxin Y1 (.1) Lus10028569 17.7 0.8739
AT1G09900 Pentatricopeptide repeat (PPR-... Lus10031564 22.7 0.8696
AT5G11580 Regulator of chromosome conden... Lus10038724 24.8 0.8628
AT4G25080 CHLM magnesium-protoporphyrin IX me... Lus10016730 25.6 0.8785

Lus10030808 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.