Lus10030819 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G59900 124 / 8e-36 AT-E1 ALPHA, AT-E1ALPHA pyruvate dehydrogenase complex E1 alpha subunit (.1)
AT1G24180 119 / 1e-33 IAR4 IAA-CONJUGATE-RESISTANT 4, Thiamin diphosphate-binding fold (THDP-binding) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013295 160 / 2e-49 AT1G59900 687 / 0.0 pyruvate dehydrogenase complex E1 alpha subunit (.1)
Lus10029216 131 / 2e-38 AT1G59900 695 / 0.0 pyruvate dehydrogenase complex E1 alpha subunit (.1)
Lus10010728 130 / 6e-38 AT1G59900 687 / 0.0 pyruvate dehydrogenase complex E1 alpha subunit (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G038400 132 / 7e-39 AT1G59900 651 / 0.0 pyruvate dehydrogenase complex E1 alpha subunit (.1)
Potri.008G192500 126 / 2e-36 AT1G59900 673 / 0.0 pyruvate dehydrogenase complex E1 alpha subunit (.1)
PFAM info
Representative CDS sequence
>Lus10030819 pacid=23155298 polypeptide=Lus10030819 locus=Lus10030819.g ID=Lus10030819.BGIv1.0 annot-version=v1.0
ATGTCCTCCTCCTTCCTCCGTCAAATCTCAACTTCAACAGAGCCCCTAACAATCGAAACATCGATCCCTTTCACCGCCCACAACTGCTCCCCTCCCTCCC
GCTCCGTCGACACCACTCCGAACGAGCTCATGTCATTCTTCCGCGACATGGCCCTCATGCGCCGGATGGAGATCGCCGCCGACTCGCTCTACAAGGCCAA
GCTCATCCGCGGATTCTGCCATCTCTACGTCGGGCTGCGGGTCGGGCCGTCTGCGTAG
AA sequence
>Lus10030819 pacid=23155298 polypeptide=Lus10030819 locus=Lus10030819.g ID=Lus10030819.BGIv1.0 annot-version=v1.0
MSSSFLRQISTSTEPLTIETSIPFTAHNCSPPSRSVDTTPNELMSFFRDMALMRRMEIAADSLYKAKLIRGFCHLYVGLRVGPSA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G59900 AT-E1 ALPHA, AT... pyruvate dehydrogenase complex... Lus10030819 0 1
AT5G48560 bHLH bHLH078 basic helix-loop-helix (bHLH) ... Lus10002337 2.0 0.9009
AT1G59900 AT-E1 ALPHA, AT... pyruvate dehydrogenase complex... Lus10030820 2.8 0.9169
AT1G70330 "ENT1,AT", ENT1... equilibrative nucleotide trans... Lus10013002 6.3 0.8694
AT5G11710 ENTH/VHS family protein (.1) Lus10005498 6.5 0.8901
AT4G39220 ATRER1A Rer1 family protein (.1) Lus10019323 7.2 0.8942
Lus10019700 9.8 0.8535
AT5G10840 Endomembrane protein 70 protei... Lus10042415 10.2 0.8964
AT1G34550 EMB2756 EMBRYO DEFECTIVE 2756, Protein... Lus10028702 10.2 0.8895
AT1G08280 Glycosyltransferase family 29 ... Lus10043382 13.8 0.8782
AT2G36530 ENO2, LOS2 LOW EXPRESSION OF OSMOTICALLY ... Lus10002844 14.3 0.8930

Lus10030819 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.