Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G22390 44 / 9e-06 F-box associated ubiquitination effector family protein (.1) AT3G06240 40 / 0.0002 F-box family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001105 [exp] 47 / 1e-06 AT3G06240 109 / 3e-26 F-box family protein (.1) Lus10027824 [exp] 45 / 4e-06 AT3G06240 78 / 2e-15 F-box family protein (.1) Lus10006687 [exp] 43 / 2e-05 AT4G12560 81 / 5e-17 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Lus10007848 [exp] 43 / 2e-05 AT3G10430 73 / 5e-14 F-box and associated interaction domains-containing protein (.1) Lus10028961 [exp] 43 / 2e-05 AT4G12560 81 / 2e-16 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Lus10039593 [exp] 43 / 2e-05 AT4G12560 75 / 9e-16 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Lus10031020 [exp] 43 / 3e-05 AT3G10430 88 / 3e-19 F-box and associated interaction domains-containing protein (.1) Lus10043335 [exp] 42 / 4e-05 AT4G12560 84 / 2e-18 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Lus10040800 [exp] 42 / 5e-05 AT3G21120 84 / 8e-18 F-box and associated interaction domains-containing protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G099733 [exp] 65 / 6e-13 AT3G16210 92 / 2e-20 F-box family protein (.1) Potri.017G012200 [exp] 61 / 1e-11 AT4G12560 86 / 4e-18 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.005G114900 [exp] 45 / 4e-06 AT3G21410 73 / 9e-14 F-box and associated interaction domains-containing protein (.1) Potri.017G058900 [exp] 44 / 8e-06 AT3G06240 132 / 2e-34 F-box family protein (.1) Potri.012G014300 [exp] 44 / 9e-06 AT3G16210 88 / 6e-19 F-box family protein (.1) Potri.010G207500 [exp] 44 / 1e-05 AT4G12560 94 / 3e-21 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.001G318300 [exp] 40 / 0.0002 AT3G06240 140 / 7e-38 F-box family protein (.1) Potri.001G318400 [exp] 39 / 0.0004 AT3G06240 142 / 3e-38 F-box family protein (.1) Potri.016G012500 [exp] 39 / 0.0005 AT4G12560 321 / 8e-107 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.010G154700 [exp] 39 / 0.0005 AT4G12560 321 / 8e-107 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10030826 pacid=23155270 polypeptide=Lus10030826 locus=Lus10030826.g ID=Lus10030826.BGIv1.0 annot-version=v1.0 ATGCGCTTCGGCGCAAACAACTGGCCAAGCTGCTATCAGAATTTCCCAATGCAGGTCATTTCGGGACCCTGCAACGGTGTATATTTACTCGGGTATCCCA CTGAGCTACGTCTCGAATATTCGCTGTGGAATCCTGCGACCGGCTCTCTGAGGGAACTTCCTGTACCCAGAACCAACAACTATGAATTTTATGCTCAGAG TTACGGCTTTGGGATCGATACTGTTTCGGACGACTTCAAAGTCGTTCTGATACTACACTCTTGCCTGCCCGTAAATTACCCTCGTCGGTCAAGATTATGC AGAGGCGGGCGTTCTTCACCCGAATGCCCTTCGAGAGTGATGGTGTACTCGCTTCGCACCGACGCGTGGAAGAGTTGGACGAGCTTAGGCATGATTTCGA GACAGTCGGATTCACGGAATGCCGGTACATGA
AA sequence Show only first row Show all	>Lus10030826 pacid=23155270 polypeptide=Lus10030826 locus=Lus10030826.g ID=Lus10030826.BGIv1.0 annot-version=v1.0 MRFGANNWPSCYQNFPMQVISGPCNGVYLLGYPTELRLEYSLWNPATGSLRELPVPRTNNYEFYAQSYGFGIDTVSDDFKVVLILHSCLPVNYPRRSRLC RGGRSSPECPSRVMVYSLRTDAWKSWTSLGMISRQSDSRNAGT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G22390			F-box associated ubiquitinatio...		Lus10030826 [exp]	0	1
AT1G13570			F-box/RNI-like superfamily pro...		Lus10041818 [exp]	3.0	0.7959
AT5G14180		MPL1	Myzus persicae-induced lipase ...		Lus10023171 [exp]	4.6	0.8027
AT4G09740		ATGH9B14	glycosyl hydrolase 9B14 (.1)		Lus10017525 [exp]	5.0	0.7826
AT2G37980			O-fucosyltransferase family pr...		Lus10028253 [exp]	8.5	0.7506
AT2G33530		SCPL46	serine carboxypeptidase-like 4...		Lus10040327 [exp]	13.3	0.7978
AT4G14750		IQD19	IQ-domain 19 (.1)		Lus10015930 [exp]	14.1	0.7716
AT4G15040			Subtilisin-like serine endopep...		Lus10028843 [exp]	15.2	0.6991
AT5G16080		ATCXE17	carboxyesterase 17 (.1)		Lus10033548 [exp]	23.2	0.7518
					Lus10037930 [exp]	27.5	0.7382
AT4G18210		ATPUP10	purine permease 10 (.1)		Lus10026130 [exp]	28.4	0.7634

Compare expression of checked genes

Lus10030826 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.