Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G23965 49 / 1e-08 unknown protein AT1G70270 45 / 3e-07 unknown protein AT2G43060 43 / 4e-06 bHLH AtIBH1, bHLH158 ILI1 binding bHLH 1 (.1) AT5G57780 39 / 0.0002 P1R1 P1R1, unknown protein AT4G30410 39 / 0.0002 sequence-specific DNA binding transcription factors (.1.2) AT2G42870 38 / 0.0002 PAR1 ,HLH1 HELIX-LOOP-HELIX 1, phy rapidly regulated 1 (.1) AT3G58850 38 / 0.0002 HLH2, PAR2 phy rapidly regulated 2 (.1) AT2G18969 38 / 0.0002 unknown protein AT3G05800 37 / 0.0009 bHLH bHLH150, AIF1 AtBS1(activation-tagged BRI1 suppressor 1)-interacting factor 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030641 [exp] 121 / 2e-37 AT1G23965 42 / 3e-06 unknown protein Lus10026730 [exp] 45 / 7e-07 AT2G43060 97 / 4e-26 ILI1 binding bHLH 1 (.1) Lus10025511 [exp] 42 / 1e-05 AT2G43060 98 / 9e-27 ILI1 binding bHLH 1 (.1) Lus10002419 [exp] 37 / 0.0004 AT2G47270 67 / 4e-16 UPBEAT1, sequence-specific DNA binding transcription factors;transcription regulators (.1) Lus10001447 [exp] 37 / 0.0005 AT2G47270 69 / 2e-16 UPBEAT1, sequence-specific DNA binding transcription factors;transcription regulators (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G118300 [exp] 43 / 2e-06 AT2G47270 62 / 2e-13 UPBEAT1, sequence-specific DNA binding transcription factors;transcription regulators (.1) Potri.002G060100 [exp] 41 / 2e-05 AT3G58850 80 / 4e-20 phy rapidly regulated 2 (.1) Potri.002G193300 [exp] 40 / 2e-05 AT2G47270 79 / 5e-20 UPBEAT1, sequence-specific DNA binding transcription factors;transcription regulators (.1) Potri.005G201500 [exp] 40 / 4e-05 AT3G58850 82 / 4e-21 phy rapidly regulated 2 (.1) Potri.014G149800 [exp] 39 / 9e-05 AT2G43060 82 / 3e-20 ILI1 binding bHLH 1 (.1) Potri.006G177000 [exp] 39 / 0.0001 AT4G30410 142 / 2e-43 sequence-specific DNA binding transcription factors (.1.2) Potri.018G099100 [exp] 39 / 0.0002 AT4G30410 135 / 1e-40 sequence-specific DNA binding transcription factors (.1.2) Potri.002G232500 [exp] 37 / 0.0004 AT2G43060 79 / 1e-18 ILI1 binding bHLH 1 (.1) Potri.017G093000 [exp] 37 / 0.0005 AT5G39240 64 / 3e-14 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10030844 pacid=23155238 polypeptide=Lus10030844 locus=Lus10030844.g ID=Lus10030844.BGIv1.0 annot-version=v1.0 ATGGCCGTTACCACTACTCTGGTGGCCGTGAGCAACAAAACCAAGAGCAGACTTCTGAGGAGAAGAAGATCCGCCGCACTACTAAGGAGTCGACGGAGCA GCAACGCTATCGTCGGAGGTAGGAAGACGGCGGTGGGGTTGAAGGTGAAGAAGCTGAGGAAGCTCATCCCTGGCGGCGAAGGGATGGAGGCGGATCGGTT GCTTTTGAAGACCGCCGACTATATATTGCATCTGAGGTTTCAACTCCACGTTTTGCAGTCCCTCTCCAACATTGTTCAGTAA
AA sequence Show only first row Show all	>Lus10030844 pacid=23155238 polypeptide=Lus10030844 locus=Lus10030844.g ID=Lus10030844.BGIv1.0 annot-version=v1.0 MAVTTTLVAVSNKTKSRLLRRRRSAALLRSRRSSNAIVGGRKTAVGLKVKKLRKLIPGGEGMEADRLLLKTADYILHLRFQLHVLQSLSNIVQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G23965			unknown protein		Lus10030844 [exp]	0	1
AT5G57970			DNA glycosylase superfamily pr...		Lus10038388 [exp]	1.4	0.9460
AT5G44680			DNA glycosylase superfamily pr...		Lus10036248 [exp]	2.4	0.9448
AT2G02800		Kin2, APK2B	protein kinase 2B (.1.2)		Lus10008627 [exp]	3.0	0.9354
AT3G27580		D6PKL3, ATPK7	D6 PROTEIN KINASE LIKE 3, Prot...		Lus10022272 [exp]	5.7	0.8922
AT2G20760			Clathrin light chain protein (...		Lus10039815 [exp]	6.7	0.8951
AT3G28857	bHLH	PRE5	Paclobutrazol Resistance 5, ba...		Lus10005248 [exp]	6.7	0.8896
AT1G69780	HD	ATHB13	Homeobox-leucine zipper protei...		Lus10012845 [exp]	7.2	0.8915
AT5G50335			unknown protein		Lus10008207 [exp]	7.3	0.8883
AT5G15350		AtENODL17	early nodulin-like protein 17 ...		Lus10014356 [exp]	8.4	0.9180
AT3G24670			Pectin lyase-like superfamily ...		Lus10022817 [exp]	8.8	0.9084

Compare expression of checked genes

Lus10030844 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.