Lus10030875 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G10600 311 / 2e-108 AMSH2 associated molecule with the SH3 domain of STAM 2 (.1.2.3)
AT1G48790 254 / 3e-82 AMSH1 associated molecule with the SH3 domain of STAM 1 (.1)
AT4G16144 251 / 5e-81 AMSH3 associated molecule with the SH3 domain of STAM 3 (.1)
AT5G23540 51 / 2e-07 Mov34/MPN/PAD-1 family protein (.1.2)
AT1G22920 44 / 6e-05 CSN5A, JAB1, AJH1 ARABIDOPSIS JAB1 HOMOLOG 1, COP9 signalosome 5A (.1.2)
AT1G71230 40 / 0.0009 CSN5B, AJH2 COP9-signalosome 5B (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030613 434 / 4e-156 AT1G10600 253 / 5e-85 associated molecule with the SH3 domain of STAM 2 (.1.2.3)
Lus10036454 246 / 8e-79 AT4G16144 645 / 0.0 associated molecule with the SH3 domain of STAM 3 (.1)
Lus10009006 241 / 3e-76 AT1G48790 589 / 0.0 associated molecule with the SH3 domain of STAM 1 (.1)
Lus10009634 167 / 1e-48 AT1G48790 536 / 0.0 associated molecule with the SH3 domain of STAM 1 (.1)
Lus10035470 57 / 4e-09 AT5G23540 601 / 0.0 Mov34/MPN/PAD-1 family protein (.1.2)
Lus10031085 56 / 4e-09 AT5G23540 599 / 0.0 Mov34/MPN/PAD-1 family protein (.1.2)
Lus10042663 53 / 5e-08 AT5G23540 616 / 0.0 Mov34/MPN/PAD-1 family protein (.1.2)
Lus10021746 53 / 6e-08 AT5G23540 618 / 0.0 Mov34/MPN/PAD-1 family protein (.1.2)
Lus10020149 42 / 0.0004 AT2G07560 469 / 1e-155 H\(+\)-ATPase 6, H\(+\)-ATPase 6, H(+)-ATPase 6 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G041200 310 / 5e-108 AT1G10600 256 / 3e-87 associated molecule with the SH3 domain of STAM 2 (.1.2.3)
Potri.010G141100 254 / 3e-82 AT4G16144 697 / 0.0 associated molecule with the SH3 domain of STAM 3 (.1)
Potri.015G045800 245 / 2e-78 AT1G48790 581 / 0.0 associated molecule with the SH3 domain of STAM 1 (.1)
Potri.002G127900 55 / 1e-08 AT5G23540 567 / 0.0 Mov34/MPN/PAD-1 family protein (.1.2)
Potri.014G032900 55 / 1e-08 AT5G23540 563 / 0.0 Mov34/MPN/PAD-1 family protein (.1.2)
Potri.018G006100 42 / 0.0003 AT1G22920 589 / 0.0 ARABIDOPSIS JAB1 HOMOLOG 1, COP9 signalosome 5A (.1.2)
Potri.006G275100 41 / 0.0005 AT1G22920 565 / 0.0 ARABIDOPSIS JAB1 HOMOLOG 1, COP9 signalosome 5A (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0366 JAB PF01398 JAB JAB1/Mov34/MPN/PAD-1 ubiquitin protease
Representative CDS sequence
>Lus10030875 pacid=23155428 polypeptide=Lus10030875 locus=Lus10030875.g ID=Lus10030875.BGIv1.0 annot-version=v1.0
ATGGATCCTGAATCTTGCTTATCCACACACAAATCAAGGCCTGACCTTTTCCACCACATGAAAGTTCATGCTGTTACTCAATCCTCTCCTTCCCCGGTAC
TCTCATGCGTCGAGAAAGCTCCCAGATGTGCTCAGATTTCACTGGTTCCAGCTGCTGATGTGGATGAATCTTCAAGCAACGAGCAAACAGGACCGGATTT
GCTTCGCGAAGTTCACATATCAGCACGGTTGATGGAGGATTTCCTTGAGCTGGCTAAAGAAAATACAGAGAAGGATCTTGAGACATGCGGGGTACTTGGT
GCTTTCCTTGAAAGCGGGACGTATTACGTGACAACTCTAATAATACCCAAGCAAGTGGCCACTTCCAACTCTTGTGAAGCTAAGAGGGAGGAGGAGTACT
TTACGATACAGAATGACCGGTCTCTTTCCCCCGTTGGATGGATTCACACACATCCTTCTCAGAGTTGCTTCATGTCATCAATTGATCTGCACACTCATTA
CTCATATCAGGCTATGATACCAGAGGCATTCGCAATCGTCATGGCTCCAACCGATACATCAAGAAGTTACGGTATATTCCGGATATCAGATCCTGGAGGC
ATGAGCGTGCTCAGACAGTGTCAAGAGACAGGATTCCACACTCACGACGAACCAGCAGACGGGACCCCAATCTACCAAAACTGCTCTAACGTCTACACCA
ACTCCAATCTGAGGTTCGAAATCTTCGACTTGCGATAA
AA sequence
>Lus10030875 pacid=23155428 polypeptide=Lus10030875 locus=Lus10030875.g ID=Lus10030875.BGIv1.0 annot-version=v1.0
MDPESCLSTHKSRPDLFHHMKVHAVTQSSPSPVLSCVEKAPRCAQISLVPAADVDESSSNEQTGPDLLREVHISARLMEDFLELAKENTEKDLETCGVLG
AFLESGTYYVTTLIIPKQVATSNSCEAKREEEYFTIQNDRSLSPVGWIHTHPSQSCFMSSIDLHTHYSYQAMIPEAFAIVMAPTDTSRSYGIFRISDPGG
MSVLRQCQETGFHTHDEPADGTPIYQNCSNVYTNSNLRFEIFDLR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G10600 AMSH2 associated molecule with the S... Lus10030875 0 1
AT1G55510 BCDH BETA1, BCD... branched-chain alpha-keto acid... Lus10013401 1.0 0.9736
AT5G27830 unknown protein Lus10029881 2.4 0.9570
AT5G10600 CYP81K2 "cytochrome P450, family 81, s... Lus10009909 4.9 0.9380
Lus10010883 5.1 0.9242
AT1G03090 MCCA methylcrotonyl-CoA carboxylase... Lus10042623 6.2 0.9389
AT4G32190 Myosin heavy chain-related pro... Lus10006190 6.9 0.9357
AT3G45300 IVDH, ATIVD, IV... isovaleryl-CoA-dehydrogenase (... Lus10036122 7.7 0.9358
AT5G60230 ATSEN2, SEN2 splicing endonuclease 2 (.1.2) Lus10019074 7.9 0.9348
AT4G27780 ACBP2 acyl-CoA binding protein 2 (.1... Lus10022382 8.0 0.9335
AT4G28240 Wound-responsive family protei... Lus10031617 8.5 0.9106

Lus10030875 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.