Lus10030882 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G09690 296 / 2e-104 Translation protein SH3-like family protein (.1)
AT1G09590 296 / 2e-104 Translation protein SH3-like family protein (.1)
AT1G57860 291 / 1e-102 Translation protein SH3-like family protein (.1)
AT1G57660 291 / 1e-102 Translation protein SH3-like family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030607 336 / 3e-120 AT1G09590 295 / 4e-104 Translation protein SH3-like family protein (.1)
Lus10016241 322 / 7e-115 AT1G09590 295 / 4e-104 Translation protein SH3-like family protein (.1)
Lus10029302 320 / 9e-114 AT1G09690 294 / 1e-103 Translation protein SH3-like family protein (.1)
Lus10021079 300 / 4e-106 AT1G09590 292 / 6e-103 Translation protein SH3-like family protein (.1)
Lus10017232 300 / 4e-106 AT1G09590 292 / 6e-103 Translation protein SH3-like family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G195400 305 / 7e-108 AT1G57860 305 / 5e-108 Translation protein SH3-like family protein (.1)
Potri.016G061100 302 / 5e-107 AT1G57860 305 / 7e-108 Translation protein SH3-like family protein (.1)
Potri.003G159500 295 / 3e-104 AT1G09690 305 / 4e-108 Translation protein SH3-like family protein (.1)
Potri.001G071100 290 / 4e-102 AT1G09690 307 / 7e-109 Translation protein SH3-like family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0107 KOW PF01157 Ribosomal_L21e Ribosomal protein L21e
Representative CDS sequence
>Lus10030882 pacid=23155299 polypeptide=Lus10030882 locus=Lus10030882.g ID=Lus10030882.BGIv1.0 annot-version=v1.0
ATGCCGGCTGGACATGGTCTCCGCTCCAGAACTCGAGATCTCTTCTCGAGGCCATTCAGGAAGAAGGGTTACATCCCCCTGACCACCTACCTTAGGACCT
ACAAGGTCGGCGACTATGTCGACGTCAAGGTGAACGGCGCCATCCACAAGGGTATGCCTCACAAATTCTACCACGGCCGCACCGGTCGCGTCTGGAACGT
CACAAAGCGCGCCATCGGCGTTGAGATGAACAAGCAGGTCCGTGGTAAAATCTTGAGGAAGAGGATCCACGTCAGGATCGAGCATGTTCTGCCATCAAGG
TGCACCGAGGAGCTCTCACTCAGGAAGAAGAAGAATGACGAGCTCAAGGCAGCTGCCAAGGCAAGAGGTGAGGTGATCAGCACCAAGAGGCAACCACAGG
GTCCCAAGCCTGGTTTCATGGTTGAAGGTGGTGTTACTTTGGAGACTGTCACTCCCATCCCTTACGATGTTACCAACGATCTCAAGGGCGGTTACTAG
AA sequence
>Lus10030882 pacid=23155299 polypeptide=Lus10030882 locus=Lus10030882.g ID=Lus10030882.BGIv1.0 annot-version=v1.0
MPAGHGLRSRTRDLFSRPFRKKGYIPLTTYLRTYKVGDYVDVKVNGAIHKGMPHKFYHGRTGRVWNVTKRAIGVEMNKQVRGKILRKRIHVRIEHVLPSR
CTEELSLRKKKNDELKAAAKARGEVISTKRQPQGPKPGFMVEGGVTLETVTPIPYDVTNDLKGGY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G09690 Translation protein SH3-like f... Lus10030882 0 1
AT3G25230 ROF1, ATFKBP62 FK506 BINDING PROTEIN 62, rota... Lus10002338 1.7 0.9350
AT5G60670 Ribosomal protein L11 family p... Lus10023186 2.8 0.9133
AT3G49010 RSU2, ATBBC1 40S RIBOSOMAL PROTEIN, breast ... Lus10009578 3.5 0.9099
AT2G37270 ATRPS5B ribosomal protein 5B (.1.2) Lus10013381 4.2 0.9114
AT3G10920 MSD1, MEE33, AT... MATERNAL EFFECT EMBRYO ARREST ... Lus10012883 4.7 0.8769
AT2G36620 RPL24A ribosomal protein L24 (.1) Lus10008640 6.2 0.8723
AT1G48830 Ribosomal protein S7e family p... Lus10017497 6.5 0.9004
AT3G25520 PGY3, ATL5, OLI... RIBOSOMAL PROTEIN L5 A, PIGGYB... Lus10019544 7.3 0.8813
AT5G09510 Ribosomal protein S19 family p... Lus10018777 7.7 0.8754
AT3G49470 NACA2 nascent polypeptide-associated... Lus10032927 7.7 0.8517

Lus10030882 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.