Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G23420 103 / 2e-28 YABBY INO, YAB4 INNER NO OUTER, Plant-specific transcription factor YABBY family protein (.1) AT2G26580 78 / 2e-19 YABBY YAB5 YABBY5, plant-specific transcription factor YABBY family protein (.1.2) AT1G08465 77 / 1e-18 YABBY YAB2 YABBY2, Plant-specific transcription factor YABBY family protein (.1) AT2G45190 77 / 2e-18 YABBY FIL, YAB1, AFO YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) AT1G69180 69 / 1e-15 YABBY CRC CRABS CLAW, Plant-specific transcription factor YABBY family protein (.1) AT4G00180 68 / 3e-15 YABBY YAB3 YABBY3, Plant-specific transcription factor YABBY family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030596 [exp] 179 / 1e-57 AT1G23420 194 / 8e-62 INNER NO OUTER, Plant-specific transcription factor YABBY family protein (.1) Lus10013028 [exp] 101 / 9e-28 AT1G23420 193 / 4e-62 INNER NO OUTER, Plant-specific transcription factor YABBY family protein (.1) Lus10029135 [exp] 100 / 2e-27 AT1G23420 200 / 9e-65 INNER NO OUTER, Plant-specific transcription factor YABBY family protein (.1) Lus10043264 [exp] 86 / 9e-21 AT5G35410 630 / 0.0 SNF1-RELATED PROTEIN KINASE 3.11, CBL-INTERACTING PROTEIN KINASE 24, SALT OVERLY SENSITIVE 2, Protein kinase superfamily protein (.1) Lus10019407 [exp] 79 / 3e-19 AT2G26580 228 / 8e-77 YABBY5, plant-specific transcription factor YABBY family protein (.1.2) Lus10032240 [exp] 79 / 4e-19 AT2G45190 193 / 1e-61 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Lus10024603 [exp] 79 / 4e-19 AT2G45190 190 / 2e-60 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Lus10010361 [exp] 75 / 2e-17 AT2G45190 171 / 4e-53 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Lus10008374 [exp] 73 / 3e-17 AT1G08465 84 / 9e-21 YABBY2, Plant-specific transcription factor YABBY family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G042400 [exp] 95 / 2e-25 AT1G23420 191 / 3e-61 INNER NO OUTER, Plant-specific transcription factor YABBY family protein (.1) Potri.008G189000 [exp] 92 / 3e-24 AT1G23420 213 / 7e-70 INNER NO OUTER, Plant-specific transcription factor YABBY family protein (.1) Potri.018G129800 [exp] 79 / 1e-19 AT2G26580 250 / 5e-86 YABBY5, plant-specific transcription factor YABBY family protein (.1.2) Potri.006G067800 [exp] 79 / 2e-19 AT2G26580 253 / 5e-87 YABBY5, plant-specific transcription factor YABBY family protein (.1.2) Potri.003G112800 [exp] 77 / 2e-18 AT2G45190 243 / 1e-81 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Potri.014G066700 [exp] 76 / 2e-18 AT2G45190 277 / 3e-95 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Potri.001G214700 [exp] 76 / 4e-18 AT1G08465 183 / 8e-59 YABBY2, Plant-specific transcription factor YABBY family protein (.1) Potri.001G120200 [exp] 75 / 7e-18 AT2G45190 236 / 4e-79 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Potri.002G145100 [exp] 74 / 2e-17 AT2G45190 265 / 2e-90 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Potri.008G097800 [exp] 72 / 6e-17 AT1G69180 157 / 3e-49 CRABS CLAW, Plant-specific transcription factor YABBY family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0114 [flax] [poplar] HMG-box PF04690 [flax] [poplar] YABBY YABBY protein
Representative CDS sequence Show only first row Show all	>Lus10030892 pacid=23155396 polypeptide=Lus10030892 locus=Lus10030892.g ID=Lus10030892.BGIv1.0 annot-version=v1.0 ATGACTATTTTGACGATTGTGAAGGAGCAAAAGGAAGATGGTAATCATCAAGTGGGTAGCCTATATGAAGAGAAGGGTTCATTGTTGTTCATGGATAGCA GCCCACCATTGTTGGTAACTTCTGATGAGAATGAAGATGAAGATATTAATCGCAAAATCAATAAACCTCCAGAGAAAAGGCAAAGGGCTCCTTCAGCTTA CAATCGCTTCATCAAAGAGGAGATCAAAAGGCTGAAAGCTGAGAATCCAAAGATGGTTCATAAGGAAGCTTTCAGCATGGCTGCAAAGAATGTAAATCGT AATTTTTATGTTTAA
AA sequence Show only first row Show all	>Lus10030892 pacid=23155396 polypeptide=Lus10030892 locus=Lus10030892.g ID=Lus10030892.BGIv1.0 annot-version=v1.0 MTILTIVKEQKEDGNHQVGSLYEEKGSLLFMDSSPPLLVTSDENEDEDINRKINKPPEKRQRAPSAYNRFIKEEIKRLKAENPKMVHKEAFSMAAKNVNR NFYV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G23420	YABBY	INO, YAB4	INNER NO OUTER, Plant-specific...		Lus10030892 [exp]	0	1
AT5G56980			unknown protein		Lus10025985 [exp]	2.8	0.9403
AT4G21380		ARK3	receptor kinase 3 (.1)		Lus10038556 [exp]	3.0	0.9351
AT2G17070			Arabidopsis protein of unknown...		Lus10005000 [exp]	9.3	0.8907
					Lus10004651 [exp]	11.0	0.9378
AT1G58070			unknown protein		Lus10015482 [exp]	20.8	0.9349
AT5G07220		ATBAG3	BCL-2-associated athanogene 3 ...		Lus10023279 [exp]	21.7	0.9347
AT2G46890			Protein of unknown function (D...		Lus10010291 [exp]	24.5	0.9071
AT1G05060			unknown protein		Lus10035303 [exp]	25.5	0.9178
AT4G13940		MEE58, EMB1395,...	MATERNAL EFFECT EMBRYO ARREST ...		Lus10043156 [exp]	25.9	0.9287
AT3G51490		TMT3	tonoplast monosaccharide trans...		Lus10012709 [exp]	26.5	0.8773

Compare expression of checked genes

Lus10030892 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.