Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G23420 98 / 1e-26 YABBY INO, YAB4 INNER NO OUTER, Plant-specific transcription factor YABBY family protein (.1) AT2G26580 69 / 4e-16 YABBY YAB5 YABBY5, plant-specific transcription factor YABBY family protein (.1.2) AT1G08465 66 / 7e-15 YABBY YAB2 YABBY2, Plant-specific transcription factor YABBY family protein (.1) AT4G00180 66 / 1e-14 YABBY YAB3 YABBY3, Plant-specific transcription factor YABBY family protein (.1.2) AT2G45190 65 / 5e-14 YABBY FIL, YAB1, AFO YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) AT1G69180 44 / 3e-06 YABBY CRC CRABS CLAW, Plant-specific transcription factor YABBY family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030596 [exp] 149 / 2e-46 AT1G23420 194 / 8e-62 INNER NO OUTER, Plant-specific transcription factor YABBY family protein (.1) Lus10029135 [exp] 119 / 6e-35 AT1G23420 200 / 9e-65 INNER NO OUTER, Plant-specific transcription factor YABBY family protein (.1) Lus10013028 [exp] 111 / 5e-32 AT1G23420 193 / 4e-62 INNER NO OUTER, Plant-specific transcription factor YABBY family protein (.1) Lus10024603 [exp] 77 / 2e-18 AT2G45190 190 / 2e-60 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Lus10032240 [exp] 75 / 8e-18 AT2G45190 193 / 1e-61 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Lus10019407 [exp] 69 / 2e-15 AT2G26580 228 / 8e-77 YABBY5, plant-specific transcription factor YABBY family protein (.1.2) Lus10043264 [exp] 69 / 8e-15 AT5G35410 630 / 0.0 SNF1-RELATED PROTEIN KINASE 3.11, CBL-INTERACTING PROTEIN KINASE 24, SALT OVERLY SENSITIVE 2, Protein kinase superfamily protein (.1) Lus10030105 [exp] 64 / 3e-13 AT2G26580 172 / 3e-53 YABBY5, plant-specific transcription factor YABBY family protein (.1.2) Lus10036811 [exp] 52 / 2e-09 AT1G69180 187 / 4e-61 CRABS CLAW, Plant-specific transcription factor YABBY family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G189000 [exp] 100 / 7e-28 AT1G23420 213 / 7e-70 INNER NO OUTER, Plant-specific transcription factor YABBY family protein (.1) Potri.010G042400 [exp] 97 / 1e-26 AT1G23420 191 / 3e-61 INNER NO OUTER, Plant-specific transcription factor YABBY family protein (.1) Potri.014G066700 [exp] 74 / 2e-17 AT2G45190 277 / 3e-95 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Potri.001G120200 [exp] 69 / 7e-16 AT2G45190 236 / 4e-79 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Potri.009G000100 [exp] 68 / 1e-15 AT1G08465 215 / 3e-72 YABBY2, Plant-specific transcription factor YABBY family protein (.1) Potri.018G129800 [exp] 68 / 1e-15 AT2G26580 250 / 5e-86 YABBY5, plant-specific transcription factor YABBY family protein (.1.2) Potri.006G067800 [exp] 68 / 1e-15 AT2G26580 253 / 5e-87 YABBY5, plant-specific transcription factor YABBY family protein (.1.2) Potri.002G145100 [exp] 68 / 2e-15 AT2G45190 265 / 2e-90 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Potri.003G112800 [exp] 68 / 3e-15 AT2G45190 243 / 1e-81 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Potri.016G067300 [exp] 59 / 5e-12 AT1G08465 150 / 2e-46 YABBY2, Plant-specific transcription factor YABBY family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0114 [flax] [poplar] HMG-box PF04690 [flax] [poplar] YABBY YABBY protein
Representative CDS sequence Show only first row Show all	>Lus10030893 pacid=23155273 polypeptide=Lus10030893 locus=Lus10030893.g ID=Lus10030893.BGIv1.0 annot-version=v1.0 ATGTCGTCAACAGTCAGCAGCCAACTGTTTGATCTACCAGCAGCAGCAGCAGCAGCAGAGGACCAGATCTGCTATGTCCAGTGTGGCTTCTGCACCACCA TCTTACTGGTGAGTGTGCCATGCAGCAGCTTGTCAATGGTGGTTACAGTGAGGTGTGGCCATTGCACTAGCTTGCTCTCTGTCAATATGATCAAAGCCTC TTTCCTTCCCTTCCATCTCTTGCCGGCCTCCCCCGATGTTGGACTCGACAACGACGAGGTTCATAATCAGGTAGAGGGATTGAAGTTTGCATAG
AA sequence Show only first row Show all	>Lus10030893 pacid=23155273 polypeptide=Lus10030893 locus=Lus10030893.g ID=Lus10030893.BGIv1.0 annot-version=v1.0 MSSTVSSQLFDLPAAAAAAEDQICYVQCGFCTTILLVSVPCSSLSMVVTVRCGHCTSLLSVNMIKASFLPFHLLPASPDVGLDNDEVHNQVEGLKFA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G23420	YABBY	INO, YAB4	INNER NO OUTER, Plant-specific...		Lus10030893 [exp]	0	1
AT3G29200		ATCM1, CM1	ARABIDOPSIS THALIANA CHORISMAT...		Lus10019795 [exp]	1.0	0.9083
AT4G27290			S-locus lectin protein kinase ...		Lus10037736 [exp]	9.2	0.8103
AT2G47190	MYB	AtMYB2	myb domain protein 2 (.1)		Lus10038062 [exp]	14.1	0.8319
AT1G63440		HMA5	heavy metal atpase 5 (.1)		Lus10008309 [exp]	14.6	0.8526
AT4G12440		APT4	adenine phosphoribosyl transfe...		Lus10032249 [exp]	18.1	0.8301
AT5G07830		ATGUS2	glucuronidase 2 (.1)		Lus10003468 [exp]	19.1	0.8516
AT1G76220			Arabidopsis protein of unknown...		Lus10001991 [exp]	19.7	0.8398
AT1G55790			Domain of unknown function (DU...		Lus10032898 [exp]	21.1	0.7179
AT5G07830		ATGUS2	glucuronidase 2 (.1)		Lus10015737 [exp]	25.8	0.8468
AT1G17180		ATGSTU25	glutathione S-transferase TAU ...		Lus10030020 [exp]	26.7	0.8097

Compare expression of checked genes

Lus10030893 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.