Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G47110 253 / 9e-88 UBQ6 ubiquitin 6 (.1.2) AT3G62250 251 / 3e-87 UBQ5 ubiquitin 5 (.1) AT1G23410 244 / 2e-84 Ribosomal protein S27a / Ubiquitin family protein (.1) AT1G31340 155 / 3e-49 NEDD8, ATRUB1, RUB1 ARABIDOPSIS THALIANA RELATED TO UBIQUITIN 1, related to ubiquitin 1 (.1) AT4G05050 155 / 3e-49 UBQ11 ubiquitin 11 (.1.2.3.4) AT2G35635 155 / 3e-49 UBQ7, RUB2 RELATED TO UBIQUITIN 2, ubiquitin 7 (.1) AT3G52590 154 / 3e-49 HAP4, ERD16, UBQ1, EMB2167 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1) AT2G36170 154 / 3e-49 Ubiquitin supergroup;Ribosomal protein L40e (.1) AT4G02890 155 / 3e-48 UBQ14 Ubiquitin family protein (.1.2.3.4) AT1G55060 154 / 9e-48 UBQ12 ubiquitin 12 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030595 [exp] 271 / 6e-95 AT2G47110 257 / 3e-89 ubiquitin 6 (.1.2) Lus10008873 [exp] 154 / 4e-49 AT3G52590 261 / 5e-92 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1) Lus10018367 [exp] 155 / 3e-48 AT4G05320 452 / 4e-164 polyubiquitin 10 (.1.2.3.4.5.6) Lus10010493 [exp] 59 / 1e-10 AT4G12570 830 / 0.0 ubiquitin protein ligase 5 (.1) Lus10034563 [exp] 54 / 6e-09 AT5G42220 444 / 3e-148 Ubiquitin-like superfamily protein (.1) Lus10008806 [exp] 52 / 5e-08 AT5G23740 282 / 1e-89 ribosomal protein S11-beta (.1) Lus10040001 [exp] 51 / 5e-08 AT5G25270 328 / 3e-102 Ubiquitin-like superfamily protein (.1) Lus10022411 [exp] 51 / 9e-08 AT5G24240 731 / 0.0 Phosphatidylinositol 3- and 4-kinase ;Ubiquitin family protein (.1) Lus10027323 [exp] 50 / 1e-07 AT4G12570 72 / 5e-14 ubiquitin protein ligase 5 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G025300 [exp] 263 / 9e-92 AT2G47110 257 / 3e-89 ubiquitin 6 (.1.2) Potri.012G114000 [exp] 263 / 9e-92 AT2G47110 257 / 3e-89 ubiquitin 6 (.1.2) Potri.002G190000 [exp] 263 / 9e-92 AT2G47110 257 / 3e-89 ubiquitin 6 (.1.2) Potri.015G111500 [exp] 263 / 9e-92 AT2G47110 257 / 3e-89 ubiquitin 6 (.1.2) Potri.014G115100 [exp] 261 / 6e-91 AT2G47110 255 / 2e-88 ubiquitin 6 (.1.2) Potri.016G077000 [exp] 155 / 7e-50 AT3G52590 194 / 1e-65 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1) Potri.015G007100 [exp] 155 / 3e-49 AT3G52590 260 / 2e-91 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1) Potri.012G024300 [exp] 155 / 3e-49 AT3G52590 260 / 2e-91 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1) Potri.016G077200 [exp] 155 / 3e-49 AT3G52590 260 / 2e-91 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1) Potri.002G062500 [exp] 155 / 4e-49 AT1G31340 296 / 9e-105 ARABIDOPSIS THALIANA RELATED TO UBIQUITIN 1, related to ubiquitin 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [flax] [poplar] Ubiquitin PF00240 [flax] [poplar] ubiquitin Ubiquitin family CL0167 [flax] [poplar] Zn_Beta_Ribbon PF01599 [flax] [poplar] Ribosomal_S27 Ribosomal protein S27a
Representative CDS sequence Show only first row Show all	>Lus10030894 pacid=23155341 polypeptide=Lus10030894 locus=Lus10030894.g ID=Lus10030894.BGIv1.0 annot-version=v1.0 ATGCAGATCTTCGTGAAAACCCTAACCGGGAAGACCATCACCCTCGAGGTCGAGTCCTCGGACACGATCGACAATGTCAAGGCCAAGATCCAGGACAAGG AAGGAATCCCACCCGACCAGCAGCGTCTGATCTTCGCCGGGAAGCAGCTGGAAGACGGCCGCACTTTAGCCGACTACAACATCCAGAAGGAGTCGACGCT CCACCTGGTGCTCCGCCTCCGCGGTGGCGCCAAGAAGAGGAAGAAGAAGGTGTTCACCAAGCCGAAGAAGATCAAGCATAAGAAGAAGAAGGTGAAGCTC GCGATCCTCCAGTTCTACAAGGTGGAGGACTCCGGCAAGGTCCAGAGGCTGAGGAAGGAGTGCCCCAACGCCGAGTGCGGAGCTGGTACGTTTATGGCCA ACCACTTTGACAGGCACTACTGTGGCAAGTGCGGGATGACCTATGTTTACAACAAGGCCGGCTCTGATTAG
AA sequence Show only first row Show all	>Lus10030894 pacid=23155341 polypeptide=Lus10030894 locus=Lus10030894.g ID=Lus10030894.BGIv1.0 annot-version=v1.0 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKVFTKPKKIKHKKKKVKL AILQFYKVEDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGMTYVYNKAGSD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G47110		UBQ6	ubiquitin 6 (.1.2)		Lus10030894 [exp]	0	1
AT2G15000			unknown protein		Lus10025365 [exp]	2.4	0.8830
AT3G25230		ROF1, ATFKBP62	FK506 BINDING PROTEIN 62, rota...		Lus10003171 [exp]	8.2	0.8859
AT2G17870		ATCSP3	ARABIDOPSIS COLD SHOCK DOMAIN ...		Lus10005066 [exp]	8.9	0.8699
AT2G40290			Eukaryotic translation initiat...		Lus10007521 [exp]	9.5	0.8614
AT2G20710			Tetratricopeptide repeat (TPR)...		Lus10018588 [exp]	9.8	0.8803
AT3G55605			Mitochondrial glycoprotein fam...		Lus10001015 [exp]	10.1	0.8467
AT2G37400			Tetratricopeptide repeat (TPR)...		Lus10024433 [exp]	10.2	0.8644
AT5G61030		GR-RBP3	glycine-rich RNA-binding prote...		Lus10017852 [exp]	11.0	0.8745
AT2G21060		ATCSP4, ATGRP2B	COLD SHOCK DOMAIN PROTEIN 4, g...		Lus10027839 [exp]	14.4	0.8549
AT3G55605			Mitochondrial glycoprotein fam...		Lus10001017 [exp]	16.1	0.8434

Compare expression of checked genes

Lus10030894 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.