Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030572 [exp] 88 / 2e-24 AT1G13590 51 / 7e-10 phytosulfokine 1 precursor (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06404 [flax] [poplar] PSK Phytosulfokine precursor protein (PSK)
Representative CDS sequence Show only first row Show all	>Lus10030916 pacid=23155302 polypeptide=Lus10030916 locus=Lus10030916.g ID=Lus10030916.BGIv1.0 annot-version=v1.0 ATGGCTGGGAAATCTGGGCATTTCTTTGTATTAACAATGGTTATTCTCAGCTTAGCATTGGTCTCAGTACTGTCTGCAGAAGCCATCCGGCCATCGGTCC CTGAACCGGACCCAACGCCTGAGATGGAGTATCATGAGGATGGTGGTGGGTGTGTAGGAAGAGGGGATGAAGAAGGGTGTTTGATGAGGAGGGTCGTGGC TGTTGCTCATACTGATTATATCTACACTCAAGATGTCAATGTTCATGGGCCTTGA
AA sequence Show only first row Show all	>Lus10030916 pacid=23155302 polypeptide=Lus10030916 locus=Lus10030916.g ID=Lus10030916.BGIv1.0 annot-version=v1.0 MAGKSGHFFVLTMVILSLALVSVLSAEAIRPSVPEPDPTPEMEYHEDGGGCVGRGDEEGCLMRRVVAVAHTDYIYTQDVNVHGP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G13590		ATPSK1	phytosulfokine 1 precursor (.1...		Lus10030916 [exp]	0	1
AT5G48130			Phototropic-responsive NPH3 fa...		Lus10001164 [exp]	1.0	0.9163
AT3G19200			unknown protein		Lus10014046 [exp]	1.4	0.9139
AT2G45410	AS2	LBD19	LOB domain-containing protein ...		Lus10009298 [exp]	3.9	0.8717
AT1G13590		ATPSK1	phytosulfokine 1 precursor (.1...		Lus10030572 [exp]	5.8	0.8700
AT5G65660			hydroxyproline-rich glycoprote...		Lus10028221 [exp]	5.9	0.8930
AT5G48130			Phototropic-responsive NPH3 fa...		Lus10001738 [exp]	8.9	0.8531
AT2G47730		GST6, ATGSTF5, ...	Arabidopsis thaliana glutathio...		Lus10030414 [exp]	15.7	0.8970
AT3G20015			Eukaryotic aspartyl protease f...		Lus10010157 [exp]	15.9	0.8904
AT3G20015			Eukaryotic aspartyl protease f...		Lus10017362 [exp]	17.0	0.8910
AT2G01980		ATSOS1, SOS1, A...	ARABIDOPSIS SALT OVERLY SENSIT...		Lus10039133 [exp]	22.0	0.8800

Compare expression of checked genes

Lus10030916 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.