Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G48310 77 / 1e-17 CYP71A22 "cytochrome P450, family 71, subfamily A, polypeptide 22", cytochrome P450, family 71, subfamily A, polypeptide 22 (.1) AT1G13080 77 / 1e-17 CYP71B2 "cytochrome P450, family 71, subfamily B, polypeptide 2", cytochrome P450, family 71, subfamily B, polypeptide 2 (.1.2) AT3G48290 76 / 4e-17 CYP71A24 "cytochrome P450, family 71, subfamily A, polypeptide 24", cytochrome P450, family 71, subfamily A, polypeptide 24 (.1.2) AT4G13310 73 / 3e-16 CYP71A20 "cytochrome P450, family 71, subfamily A, polypeptide 20", cytochrome P450, family 71, subfamily A, polypeptide 20 (.1.2) AT3G48280 73 / 3e-16 CYP71A25 "cytochrome P450, family 71, subfamily A, polypeptide 25", cytochrome P450, family 71, subfamily A, polypeptide 25 (.1) AT3G48320 72 / 5e-16 CYP71A21 "cytochrome P450, family 71, subfamily A, polypeptide 21", cytochrome P450, family 71, subfamily A, polypeptide 21 (.1) AT5G25120 71 / 2e-15 CYP71B11 "ytochrome p450, family 71, subfamily B, polypeptide 11", ytochrome p450, family 71, subfamily B, polypeptide 11 (.1) AT3G44250 70 / 5e-15 CYP71B38 "cytochrome P450, family 71, subfamily B, polypeptide 38", cytochrome P450, family 71, subfamily B, polypeptide 38 (.1) AT5G25140 69 / 8e-15 CYP71B13 "cytochrome P450, family 71, subfamily B, polypeptide 13", cytochrome P450, family 71, subfamily B, polypeptide 13 (.1) AT4G13290 69 / 9e-15 CYP71A19 "cytochrome P450, family 71, subfamily A, polypeptide 19", cytochrome P450, family 71, subfamily A, polypeptide 19 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030924 [exp] 132 / 1e-37 AT3G26300 391 / 2e-131 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Lus10040120 [exp] 123 / 4e-34 AT3G48280 377 / 5e-126 "cytochrome P450, family 71, subfamily A, polypeptide 25", cytochrome P450, family 71, subfamily A, polypeptide 25 (.1) Lus10009903 [exp] 87 / 3e-21 AT5G57260 376 / 1e-125 "cytochrome P450, family 71, subfamily B, polypeptide 10", cytochrome P450, family 71, subfamily B, polypeptide 10 (.1) Lus10038158 [exp] 87 / 7e-21 AT5G25140 353 / 2e-116 "cytochrome P450, family 71, subfamily B, polypeptide 13", cytochrome P450, family 71, subfamily B, polypeptide 13 (.1) Lus10016601 [exp] 86 / 2e-20 AT3G26320 402 / 6e-136 "cytochrome P450, family 71, subfamily B, polypeptide 36", cytochrome P450, family 71, subfamily B, polypeptide 36 (.1) Lus10019157 [exp] 84 / 8e-20 AT3G48300 358 / 1e-118 "cytochrome P450, family 71, subfamily A, polypeptide 23", cytochrome P450, family 71, subfamily A, polypeptide 23 (.1) Lus10017676 [exp] 81 / 5e-19 AT3G26300 367 / 3e-122 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Lus10012879 [exp] 81 / 6e-19 AT3G26330 409 / 6e-138 "cytochrome P450, family 71, subfamily B, polypeptide 37", cytochrome P450, family 71, subfamily B, polypeptide 37 (.1) Lus10013194 [exp] 81 / 7e-19 AT5G25120 387 / 9e-130 "ytochrome p450, family 71, subfamily B, polypeptide 11", ytochrome p450, family 71, subfamily B, polypeptide 11 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G074900 [exp] 87 / 4e-21 AT3G26300 383 / 3e-128 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.007G074850 [exp] 87 / 5e-21 AT3G26300 379 / 1e-126 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.007G075000 [exp] 86 / 1e-20 AT3G26300 386 / 2e-129 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.008G223500 [exp] 85 / 2e-20 AT3G26300 395 / 3e-133 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.011G130850 [exp] 85 / 2e-20 AT3G26300 361 / 5e-120 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.007G074300 [exp] 85 / 3e-20 AT3G26300 343 / 6e-113 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.011G130800 [exp] 84 / 6e-20 AT3G26300 359 / 4e-119 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.002G026500 [exp] 84 / 6e-20 AT4G31500 489 / 8e-170 SUPERROOT 2, RUNT 1, RED ELONGATED 1, "cytochrome P450, family 83, subfamily B, polypeptide 1", ALTERED TRYPTOPHAN REGULATION 4, cytochrome P450, family 83, subfamily B, polypeptide 1 (.1) Potri.002G025800 [exp] 84 / 6e-20 AT4G31500 490 / 3e-170 SUPERROOT 2, RUNT 1, RED ELONGATED 1, "cytochrome P450, family 83, subfamily B, polypeptide 1", ALTERED TRYPTOPHAN REGULATION 4, cytochrome P450, family 83, subfamily B, polypeptide 1 (.1) Potri.002G025500 [exp] 83 / 8e-20 AT4G31500 502 / 6e-175 SUPERROOT 2, RUNT 1, RED ELONGATED 1, "cytochrome P450, family 83, subfamily B, polypeptide 1", ALTERED TRYPTOPHAN REGULATION 4, cytochrome P450, family 83, subfamily B, polypeptide 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [flax] [poplar] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Lus10030925 pacid=23166750 polypeptide=Lus10030925 locus=Lus10030925.g ID=Lus10030925.BGIv1.0 annot-version=v1.0 ATGACCCTCACGTTTTACAACTCGACTGACGTGGCGTTAGTGCCCTACGGTCGTTACTGGAGGCAATTGAAGAAGATATGCACGGTGGAGCTGCTGAGCT CGAAGCACGTGCAGTCCTATCGCCACATGAGGGAAGAGGAGGTGTCCCGCTGTGTTGAAAACATCGCCCAAATTGTAATGAACAGTGGCACCGGGCCGGT CGTCGTTGACCTGAGCAGGGAGATGAGGAGGTTCACATCGAGCGTGATAGCGAGATCGGTGTTTGGGGAGGAGTGTGCGGAGGCGAAGGAGTTCTTGTCT CACACAAACGATCGTGTTGAGCTGGCGGGAGGTTCCGGTCTATGA
AA sequence Show only first row Show all	>Lus10030925 pacid=23166750 polypeptide=Lus10030925 locus=Lus10030925.g ID=Lus10030925.BGIv1.0 annot-version=v1.0 MTLTFYNSTDVALVPYGRYWRQLKKICTVELLSSKHVQSYRHMREEEVSRCVENIAQIVMNSGTGPVVVDLSREMRRFTSSVIARSVFGEECAEAKEFLS HTNDRVELAGGSGL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G48310		CYP71A22	"cytochrome P450, family 71, s...		Lus10030925 [exp]	0	1

Compare expression of checked genes

Lus10030925 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.