Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G38740 166 / 7e-53 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein (.1) AT4G21470 45 / 3e-06 ATFMN/FHY riboflavin kinase/FMN hydrolase (.1) AT4G39970 42 / 2e-05 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040116 [exp] 225 / 4e-76 AT2G38740 347 / 3e-122 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein (.1) Lus10003018 [exp] 177 / 9e-57 AT2G38740 355 / 1e-124 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein (.1) Lus10018906 [exp] 58 / 5e-11 AT4G21470 556 / 0.0 riboflavin kinase/FMN hydrolase (.1) Lus10028605 [exp] 56 / 3e-10 AT4G21470 558 / 0.0 riboflavin kinase/FMN hydrolase (.1) Lus10018435 [exp] 47 / 5e-07 AT4G21470 553 / 0.0 riboflavin kinase/FMN hydrolase (.1) Lus10000633 [exp] 45 / 2e-06 AT4G39970 427 / 1e-151 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein (.1) Lus10023149 [exp] 44 / 4e-06 AT4G39970 423 / 4e-150 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein (.1) Lus10002002 [exp] 40 / 0.0001 AT4G11570 491 / 9e-175 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein (.1), Haloacid dehalogenase-like hydrolase (HAD) superfamily protein (.2) Lus10035494 [exp] 40 / 0.0001 AT4G11570 493 / 2e-175 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein (.1), Haloacid dehalogenase-like hydrolase (HAD) superfamily protein (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G086900 [exp] 177 / 2e-57 AT2G38740 359 / 6e-127 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein (.1) Potri.001G147300 [exp] 177 / 3e-57 AT2G38740 360 / 5e-127 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein (.1) Potri.001G147400 [exp] 163 / 7e-52 AT2G38740 350 / 2e-123 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein (.1) Potri.014G043500 [exp] 130 / 2e-38 AT2G38740 297 / 1e-101 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein (.1) Potri.002G135000 [exp] 82 / 2e-20 AT2G38740 176 / 4e-55 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein (.1) Potri.002G077200 [exp] 49 / 1e-07 AT4G21470 561 / 0.0 riboflavin kinase/FMN hydrolase (.1) Potri.005G183400 [exp] 46 / 8e-07 AT4G21470 575 / 0.0 riboflavin kinase/FMN hydrolase (.1) Potri.007G095200 [exp] 42 / 2e-05 AT4G39970 439 / 3e-156 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0137 [flax] [poplar] HAD PF00702 [flax] [poplar] Hydrolase haloacid dehalogenase-like hydrolase
Representative CDS sequence Show only first row Show all	>Lus10030929 pacid=23166757 polypeptide=Lus10030929 locus=Lus10030929.g ID=Lus10030929.BGIv1.0 annot-version=v1.0 ATGATCTCAAAGCTCGGGCTGACCGATTTCTTCCAAGCTGTCATTCTCGGAGATGATTGCGAGCATGCGAAGCCTCACCCAGAACCTTACCTGAAAGCTC TGGACGTGCTCAAAGTGTCAAAGGATCACACTTTTGTTTTCGAGGATTCTGTATCTGGAATAAAAGCTGGAGTTGCAGCTGGGTTGCCAGTCATCGGTAT AGCCACTAGGAATCCTGAGGACTTGCTGATGACAGCAAAGCCTACCTTTCTGATAAAGAACTACGCAGATCCGAAACTGTGGGAAGCTCTCGAACAAGTC GATAAATTTACGGCAGCTGGGAAGCAACATACTGATTGA
AA sequence Show only first row Show all	>Lus10030929 pacid=23166757 polypeptide=Lus10030929 locus=Lus10030929.g ID=Lus10030929.BGIv1.0 annot-version=v1.0 MISKLGLTDFFQAVILGDDCEHAKPHPEPYLKALDVLKVSKDHTFVFEDSVSGIKAGVAAGLPVIGIATRNPEDLLMTAKPTFLIKNYADPKLWEALEQV DKFTAAGKQHTD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G38740			Haloacid dehalogenase-like hyd...		Lus10030929 [exp]	0	1
AT1G10370		GST30B, ATGSTU1...	GLUTATHIONE S-TRANSFERASE U17,...		Lus10030805 [exp]	2.4	0.9760
AT2G38740			Haloacid dehalogenase-like hyd...		Lus10040116 [exp]	3.2	0.9736
AT3G43790		ZIFL2	zinc induced facilitator-like ...		Lus10037425 [exp]	4.4	0.9575
AT4G36220		CYP84A1, FAH1, ...	ferulic acid 5-hydroxylase 1 (...		Lus10012582 [exp]	4.6	0.9566
AT2G47485			unknown protein		Lus10009156 [exp]	5.2	0.9720
AT3G51680		AtSDR2	short-chain dehydrogenase/redu...		Lus10013594 [exp]	8.0	0.9699
AT1G70170		MMP	matrix metalloproteinase (.1)		Lus10029207 [exp]	11.4	0.9635
AT5G56260			Ribonuclease E inhibitor RraA/...		Lus10032885 [exp]	12.7	0.9688
AT4G36810		GGPS1	geranylgeranyl pyrophosphate s...		Lus10023259 [exp]	14.0	0.9695
AT1G15170			MATE efflux family protein (.1...		Lus10018134 [exp]	14.4	0.9616

Compare expression of checked genes

Lus10030929 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.