Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G59840 115 / 6e-35 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040110 [exp] 176 / 6e-59 AT3G59840 115 / 4e-35 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G146700 [exp] 138 / 6e-44 AT3G59840 111 / 2e-33 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10030936 pacid=23166815 polypeptide=Lus10030936 locus=Lus10030936.g ID=Lus10030936.BGIv1.0 annot-version=v1.0 ATGGGTCTACTCTCTTGGTTCAAAGGAAGCCCTCAACCCAATGAAGCATCCGACGACGGAAGCCCCAAACCGGCGGCGGCGACAGCCACGGCGACGGAGA TCGTAGGCATGAACGGCGCGGTAGAGGTGCCGCCCCGTCCTCCTCCGAAGAACGTGACGGTTTTCGAGTTCGGCTCGGTTGGTAGTTCAACGGATAAGGT TACGCTGGCCGGTTTCTGCCCCGTATCGGAGGACCTGGAGCCCTGCCGCTGGGAAATCCTTCCTTCTACTGACGCCGATGCACCTCAGTTCCGGGTTGTC TTCTGA
AA sequence Show only first row Show all	>Lus10030936 pacid=23166815 polypeptide=Lus10030936 locus=Lus10030936.g ID=Lus10030936.BGIv1.0 annot-version=v1.0 MGLLSWFKGSPQPNEASDDGSPKPAAATATATEIVGMNGAVEVPPRPPPKNVTVFEFGSVGSSTDKVTLAGFCPVSEDLEPCRWEILPSTDADAPQFRVV F

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G59840			unknown protein		Lus10030936 [exp]	0	1
AT1G31830			Amino acid permease family pro...		Lus10012153 [exp]	1.0	0.9200
					Lus10007581 [exp]	4.0	0.8828
AT5G52840			NADH-ubiquinone oxidoreductase...		Lus10027539 [exp]	6.6	0.9103
AT2G47550			Plant invertase/pectin methyle...		Lus10020680 [exp]	8.5	0.8843
AT2G21090			Pentatricopeptide repeat (PPR-...		Lus10005064 [exp]	9.2	0.8911
AT5G43390			Uncharacterised conserved prot...		Lus10021875 [exp]	9.4	0.8922
AT5G13890			Family of unknown function (DU...		Lus10012588 [exp]	13.7	0.8996
AT2G40780			Nucleic acid-binding, OB-fold-...		Lus10034249 [exp]	14.4	0.8182
AT1G66080			unknown protein		Lus10031356 [exp]	15.2	0.8834
AT3G13160			Tetratricopeptide repeat (TPR)...		Lus10007620 [exp]	16.4	0.8800

Compare expression of checked genes

Lus10030936 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.