Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G35380 97 / 2e-25 Peroxidase superfamily protein (.1.2) AT5G06720 90 / 9e-23 ATPA2 peroxidase 2 (.1) AT2G18150 89 / 2e-22 Peroxidase superfamily protein (.1) AT5G06730 88 / 4e-22 Peroxidase superfamily protein (.1) AT2G18140 87 / 6e-22 Peroxidase superfamily protein (.1) AT1G44970 87 / 8e-22 Peroxidase superfamily protein (.1) AT3G50990 86 / 3e-21 Peroxidase superfamily protein (.1) AT4G36430 85 / 5e-21 Peroxidase superfamily protein (.1) AT3G32980 83 / 3e-20 Peroxidase superfamily protein (.1) AT3G49110 81 / 3e-19 PRX33, PRXCA, ATPRX33, ATPCA PEROXIDASE 33, peroxidase CA (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040107 [exp] 157 / 7e-46 AT4G18010 638 / 0.0 INOSITOL\(1,4,5\)P3 5-PHOSPHATASE II, myo-inositol polyphosphate 5-phosphatase 2 (.1.2) Lus10027984 [exp] 87 / 2e-21 AT5G06730 402 / 2e-140 Peroxidase superfamily protein (.1) Lus10008174 [exp] 85 / 6e-21 AT5G06730 382 / 2e-132 Peroxidase superfamily protein (.1) Lus10027989 [exp] 84 / 1e-20 AT5G06720 400 / 1e-139 peroxidase 2 (.1) Lus10041784 [exp] 84 / 1e-20 AT5G66390 519 / 0.0 Peroxidase superfamily protein (.1) Lus10008167 [exp] 84 / 2e-20 AT5G06720 399 / 3e-139 peroxidase 2 (.1) Lus10038054 [exp] 83 / 2e-20 AT5G51890 264 / 7e-87 Peroxidase superfamily protein (.1) Lus10024206 [exp] 79 / 2e-20 AT1G14550 118 / 1e-33 Peroxidase superfamily protein (.1) Lus10008173 [exp] 83 / 3e-20 AT5G06730 407 / 3e-142 Peroxidase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G145800 [exp] 102 / 1e-27 AT2G35380 458 / 6e-163 Peroxidase superfamily protein (.1.2) Potri.001G011200 [exp] 88 / 3e-22 AT3G49120 381 / 2e-132 PEROXIDASE 34, ARABIDOPSIS THALIANA PEROXIDASE CB, peroxidase CB (.1) Potri.001G011000 [exp] 84 / 9e-21 AT3G49120 407 / 1e-142 PEROXIDASE 34, ARABIDOPSIS THALIANA PEROXIDASE CB, peroxidase CB (.1) Potri.001G011300 [exp] 83 / 2e-20 AT3G49120 410 / 8e-144 PEROXIDASE 34, ARABIDOPSIS THALIANA PEROXIDASE CB, peroxidase CB (.1) Potri.001G013000 [exp] 83 / 3e-20 AT3G49120 407 / 2e-142 PEROXIDASE 34, ARABIDOPSIS THALIANA PEROXIDASE CB, peroxidase CB (.1) Potri.003G214700 [exp] 82 / 4e-20 AT5G06720 459 / 5e-163 peroxidase 2 (.1) Potri.016G132800 [exp] 82 / 4e-20 AT5G05340 336 / 3e-115 Peroxidase superfamily protein (.1) Potri.005G118700 [exp] 82 / 5e-20 AT5G66390 504 / 0.0 Peroxidase superfamily protein (.1) Potri.007G019300 [exp] 82 / 6e-20 AT5G66390 507 / 0.0 Peroxidase superfamily protein (.1) Potri.003G214800 [exp] 82 / 7e-20 AT5G06720 451 / 5e-160 peroxidase 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0617 [flax] [poplar] Peroxidase PF00141 [flax] [poplar] peroxidase Peroxidase
Representative CDS sequence Show only first row Show all	>Lus10030940 pacid=23166880 polypeptide=Lus10030940 locus=Lus10030940.g ID=Lus10030940.BGIv1.0 annot-version=v1.0 ATGGATCATCTCATGCTCTCCTCCTCCTCCATGGTTCTTCTGCTAGGCATCATCATGGCTTGTTCCATTTCCCAAGGACAGAATCTGGTACAACAATACT ACAAGGGAACATGCCCTTCTGCAGAAGCGATTGTTAGGTACAATGTTGAGGATGCTGTGATCAAGCATCCTCGAATCGCGGCTTCCCTCATCCGCCTCCA TTTTCATGACTGCTTTGTCATGGGTTGTGATGGATCATTGCTTCTGGATACAAAAGGGGGAAGGCAGAGTGAGAAGGATGCGTAA
AA sequence Show only first row Show all	>Lus10030940 pacid=23166880 polypeptide=Lus10030940 locus=Lus10030940.g ID=Lus10030940.BGIv1.0 annot-version=v1.0 MDHLMLSSSSMVLLLGIIMACSISQGQNLVQQYYKGTCPSAEAIVRYNVEDAVIKHPRIAASLIRLHFHDCFVMGCDGSLLLDTKGGRQSEKDA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G50990			Peroxidase superfamily protein...		Lus10030940 [exp]	0	1
					Lus10011203 [exp]	6.8	0.7790
AT2G24430	NAC	ANAC039, ANAC03...	Arabidopsis NAC domain contain...		Lus10020165 [exp]	12.8	0.7329
AT5G61680			Pectin lyase-like superfamily ...		Lus10034893 [exp]	14.7	0.7829
AT2G38290		AMT2;1, ATAMT2	AMMONIUM TRANSPORTER 2;1, ammo...		Lus10018748 [exp]	18.3	0.7191
AT1G47720		OSB1	Organellar Single-stranded, Pr...		Lus10032760 [exp]	30.2	0.6818
AT2G31081		CLE4	CLAVATA3/ESR-RELATED 4 (.1)		Lus10015304 [exp]	32.0	0.7160
AT5G25900		ATKO1, CYP701A3...	CYTOCHROME P450 701 A3, ARABID...		Lus10032747 [exp]	39.9	0.7206
AT3G04720		HEL, PR-4, PR4	HEVEIN-LIKE, pathogenesis-rela...		Lus10020252 [exp]	56.8	0.6569
AT3G05060			NOP56-like pre RNA processing ...		Lus10007265 [exp]	58.2	0.6500
AT1G11940			Core-2/I-branching beta-1,6-N-...		Lus10030027 [exp]	59.2	0.6432

Compare expression of checked genes

Lus10030940 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.