Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G32370 92 / 5e-25 TTM1, TOM2B tobamovirus multiplication 2B (.1.2.3.4)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040105 [exp] 155 / 2e-50 AT1G32370 96 / 1e-26 tobamovirus multiplication 2B (.1.2.3.4)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G145500 [exp] 107 / 1e-30 AT1G32370 133 / 4e-41 tobamovirus multiplication 2B (.1.2.3.4)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10030942 pacid=23166847 polypeptide=Lus10030942 locus=Lus10030942.g ID=Lus10030942.BGIv1.0 annot-version=v1.0 ATGGCCGCCTTTGTACCATCATCCTCAGGCGGTAGTGGAACGGCAAGTATGAATGCGCCGCCGGCTACGGCAACTAACACTAGAGGAGGCACCGCTAAAG CTGCGGTGGCCGAGCAGATCTCTCAGACCGCACAACTGTCTAAACTTCCGAAGAACCTTCTGGAAAAAGCCTCGACGATTAAGAACACTGGCCAAATTCT CGAGCAGCTACCGCAGGTGATTTCAGCATTGGATGCACACATGGAAAGTGGATTGCAAAGTGCTCCTCATCTAAAAACTGTGTCTCAGATACTAGCTAAT ATGGGAAGTAGTCAGCTTAGTTCCCTGTCCTCGGCCCGTGTTGCTCAAGAGGTTTAA
AA sequence Show only first row Show all	>Lus10030942 pacid=23166847 polypeptide=Lus10030942 locus=Lus10030942.g ID=Lus10030942.BGIv1.0 annot-version=v1.0 MAAFVPSSSGGSGTASMNAPPATATNTRGGTAKAAVAEQISQTAQLSKLPKNLLEKASTIKNTGQILEQLPQVISALDAHMESGLQSAPHLKTVSQILAN MGSSQLSSLSSARVAQEV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G32370		TTM1, TOM2B	tobamovirus multiplication 2B ...		Lus10030942 [exp]	0	1
AT3G57540			Remorin family protein (.1)		Lus10026302 [exp]	13.6	0.7257
AT3G57540			Remorin family protein (.1)		Lus10042367 [exp]	15.9	0.7099
AT3G48660			Protein of unknown function (D...		Lus10035198 [exp]	20.0	0.6740
AT1G50660			unknown protein		Lus10002069 [exp]	23.7	0.6843
AT1G04635		EMB1687	EMBRYO DEFECTIVE 1687, ribonuc...		Lus10005287 [exp]	27.7	0.5762
AT3G14580			Pentatricopeptide repeat (PPR)...		Lus10042476 [exp]	29.5	0.5411
AT4G13830		J20	DNAJ-like 20 (.1.2)		Lus10000690 [exp]	41.4	0.6505
AT1G06920	OFP	ATOFP4, OFP4	ARABIDOPSIS THALIANA OVATE FAM...		Lus10014164 [exp]	52.5	0.6129
AT5G13170		SAG29, SWEET15,...	senescence-associated gene 29 ...		Lus10011335 [exp]	63.5	0.6228
AT3G46620			zinc finger (C3HC4-type RING f...		Lus10012376 [exp]	68.6	0.6164

Compare expression of checked genes

Lus10030942 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.