Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040104 [exp] 156 / 4e-51 ND 36 / 5e-04 Lus10011059 [exp] 56 / 5e-11 ND 39 / 1e-04
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G145066 [exp] 59 / 1e-12 AT1G32460 / unknown protein Potri.003G089100 [exp] 52 / 6e-10 AT1G32460 42 / 2e-06 unknown protein Potri.014G179200 [exp] 36 / 0.0006 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10030943 pacid=23166834 polypeptide=Lus10030943 locus=Lus10030943.g ID=Lus10030943.BGIv1.0 annot-version=v1.0 ATGCCCTCCCAGAATGAAAGGATTGGAGATTATATGGATATACATTCACCGTGCAAAGAGGTTTCTGAGGAGGCGGTTCGGGAGTCTCTCATCTCAATAT CTTATTCGCTTCCGGACACAGCTGTGAACTCTGGTATTAAGTCTGCAACGGACACAGCTGTGAACTCTGGTATTAAGTCTGCAACTTTGAGTAACTCGAC AGATGATGCGGCTGCTGGACTGAACAACAGCGGGATTGAGAAGTACATGTCTGAGCTCATTTCCATTTCCAATACCCAGTCGCTGGATGGTCCTGTGGAT TCAGGAAAGCACGAGACTTAG
AA sequence Show only first row Show all	>Lus10030943 pacid=23166834 polypeptide=Lus10030943 locus=Lus10030943.g ID=Lus10030943.BGIv1.0 annot-version=v1.0 MPSQNERIGDYMDIHSPCKEVSEEAVRESLISISYSLPDTAVNSGIKSATDTAVNSGIKSATLSNSTDDAAAGLNNSGIEKYMSELISISNTQSLDGPVD SGKHET

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10030943 [exp]	0	1
AT5G49710			unknown protein		Lus10000765 [exp]	6.3	0.9502
AT4G31130			Protein of unknown function (D...		Lus10026052 [exp]	7.7	0.9300
AT4G15563			unknown protein		Lus10012807 [exp]	8.1	0.9097
AT3G08710		TRXH9, ATH9	THIOREDOXIN TYPE H 9, thioredo...		Lus10022727 [exp]	10.7	0.9459
AT5G13990		ATEXO70C2	exocyst subunit exo70 family p...		Lus10012555 [exp]	10.7	0.9357
AT5G03455		ACR2, ARATH;CDC...	ARSENATE REDUCTASE 2, Rhodanes...		Lus10022616 [exp]	13.9	0.9378
AT1G04970			lipid-binding serum glycoprote...		Lus10014625 [exp]	16.7	0.9383
AT1G68300			Adenine nucleotide alpha hydro...		Lus10034337 [exp]	17.0	0.9211
					Lus10006539 [exp]	18.8	0.9251
AT1G69550			disease resistance protein (TI...		Lus10001038 [exp]	21.5	0.9258

Compare expression of checked genes

Lus10030943 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.