Lus10030954 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G46850 118 / 4e-33 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040093 273 / 1e-95 AT5G46850 115 / 8e-32 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G095200 140 / 3e-41 AT5G46850 216 / 2e-68 unknown protein
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF08320 PIG-X PIG-X / PBN1
Representative CDS sequence
>Lus10030954 pacid=23166835 polypeptide=Lus10030954 locus=Lus10030954.g ID=Lus10030954.BGIv1.0 annot-version=v1.0
ATGGTTGCTATACATGAAGCTGCATATACCTGTGTCGCTGTCTTCGGAGACACAAACTTGGAGTTGCCTTCAGTGTCTTCTAACCGGTCCGCCGTTGAGA
TTCACATGAATCTTGAGCACAGCATTTCTTCAGGAAGCATGACTGGTGCGGGAATCAAGGTCGATCTTCCATTGCATGCCCGTTATCCGCCATTGCATGA
AAGTGGTTTCTCAAAAGTAACATTTGGTACACCGGATCTGCTCGTGTGCTGCAACGTGAAAGGAAGCTTGGACACGAGTGGATGCTTGCTTGCGCCGTAC
TACAACAGCCACAAACTGAAGACTGATGCTGTATGGGAAATACCATGTGGAATTGAAAGCCATAAAAACATGGTCACAATCGTCACCTTTGCTACTGCCT
TTGTATCGACCCTTGTAATTTTACTTGCATCTCTGTTTCACTTAGAACTTCGTCGTTGA
AA sequence
>Lus10030954 pacid=23166835 polypeptide=Lus10030954 locus=Lus10030954.g ID=Lus10030954.BGIv1.0 annot-version=v1.0
MVAIHEAAYTCVAVFGDTNLELPSVSSNRSAVEIHMNLEHSISSGSMTGAGIKVDLPLHARYPPLHESGFSKVTFGTPDLLVCCNVKGSLDTSGCLLAPY
YNSHKLKTDAVWEIPCGIESHKNMVTIVTFATAFVSTLVILLASLFHLELRR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G46850 unknown protein Lus10030954 0 1
AT5G38260 Protein kinase superfamily pro... Lus10028669 8.8 0.7534
Lus10035529 15.6 0.7415
AT4G17760 damaged DNA binding;exodeoxyri... Lus10035367 17.3 0.7187
AT5G08630 DDT domain-containing protein ... Lus10029550 21.1 0.7253
AT3G04380 SDG31, SUVR4 SET DOMAIN PROTEIN 31, SET-dom... Lus10022657 23.0 0.6904
AT3G03470 CYP89A9 "cytochrome P450, family 87, s... Lus10009534 28.5 0.6342
AT1G07950 MED22B Surfeit locus protein 5 subuni... Lus10023466 36.9 0.7108
Lus10018990 39.7 0.7054
AT3G05675 BTB/POZ domain-containing prot... Lus10021269 41.3 0.7050
AT1G76405 unknown protein Lus10025161 54.4 0.7045

Lus10030954 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.