Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G32310 99 / 2e-28 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040092 [exp] 189 / 6e-64 AT1G32310 87 / 1e-23 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G138700 [exp] 135 / 1e-42 AT1G32310 97 / 1e-27 unknown protein Potri.003G095100 [exp] 108 / 5e-32 AT1G32310 91 / 5e-25 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10030955 pacid=23166782 polypeptide=Lus10030955 locus=Lus10030955.g ID=Lus10030955.BGIv1.0 annot-version=v1.0 ATGAATACCTCGCCGGCTCATTCCTCAGTTTCGACCACGGCGATCGCCGGAGATGGAAGCCGAAGCGCTTTGGAAGATTTCCACATGCCGTCCAATCTCG TCTCCATCCAGGACCGGAAGGATGAGGCTATGCTCGCTTTGAAAGCTGATCTATCAGCTGCACTAAACAAGGTGGTTACCTCATTGGATGAAGATAGCTG GAAATTCGAAGGACCTCGTTCCCGTATAAACCTTGTATCCAGACCTGGTGGGTTTCTAAACAACAAGATTGAAGCAACCAGGCGTGATAACTACGACGAC GGTCGATCAAAATGA
AA sequence Show only first row Show all	>Lus10030955 pacid=23166782 polypeptide=Lus10030955 locus=Lus10030955.g ID=Lus10030955.BGIv1.0 annot-version=v1.0 MNTSPAHSSVSTTAIAGDGSRSALEDFHMPSNLVSIQDRKDEAMLALKADLSAALNKVVTSLDEDSWKFEGPRSRINLVSRPGGFLNNKIEATRRDNYDD GRSK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G32310			unknown protein		Lus10030955 [exp]	0	1
AT2G20140		RPT2b	regulatory particle AAA-ATPase...		Lus10015524 [exp]	1.4	0.9421
AT1G02680		TAF13	TBP-associated factor 13 (.1)		Lus10028629 [exp]	1.7	0.9286
AT1G55160			unknown protein		Lus10011503 [exp]	2.0	0.9305
AT3G25910			Protein of unknown function (D...		Lus10043292 [exp]	4.0	0.9282
AT1G11740			ankyrin repeat family protein ...		Lus10020036 [exp]	10.4	0.9077
					Lus10025502 [exp]	13.0	0.9170
AT4G38360		LAZ1	LAZARUS 1, Protein of unknown ...		Lus10022626 [exp]	13.6	0.8993
AT5G03030			Chaperone DnaJ-domain superfam...		Lus10040376 [exp]	14.0	0.9086
AT3G49870		ATARLA1C	ADP-ribosylation factor-like A...		Lus10019259 [exp]	15.4	0.9000
AT2G45320			unknown protein		Lus10000786 [exp]	15.6	0.9050

Compare expression of checked genes

Lus10030955 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.