Lus10030964 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G12060 102 / 2e-28 Plant self-incompatibility protein S1 family (.1)
AT5G12070 97 / 1e-26 Plant self-incompatibility protein S1 family (.1)
AT3G16970 95 / 1e-25 Plant self-incompatibility protein S1 family (.1)
AT3G17080 94 / 3e-25 Plant self-incompatibility protein S1 family (.1)
AT1G04645 88 / 3e-23 Plant self-incompatibility protein S1 family (.1)
AT4G16195 85 / 1e-21 Plant self-incompatibility protein S1 family (.1)
AT4G24975 80 / 5e-20 Plant self-incompatibility protein S1 family (.1)
AT1G26799 68 / 3e-15 Plant self-incompatibility protein S1 family (.1)
AT4G24973 66 / 2e-14 Plant self-incompatibility protein S1 family (.1)
AT4G24974 65 / 5e-14 Plant self-incompatibility protein S1 family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030965 239 / 1e-82 AT3G16970 89 / 2e-23 Plant self-incompatibility protein S1 family (.1)
Lus10011068 137 / 2e-42 AT4G16195 103 / 5e-29 Plant self-incompatibility protein S1 family (.1)
Lus10000480 135 / 4e-42 AT5G12060 84 / 7e-22 Plant self-incompatibility protein S1 family (.1)
Lus10008107 118 / 7e-35 AT4G16195 98 / 1e-26 Plant self-incompatibility protein S1 family (.1)
Lus10013145 106 / 4e-30 AT4G16195 88 / 8e-23 Plant self-incompatibility protein S1 family (.1)
Lus10030565 97 / 1e-26 AT3G16970 91 / 7e-24 Plant self-incompatibility protein S1 family (.1)
Lus10011069 93 / 6e-25 AT4G16195 89 / 2e-23 Plant self-incompatibility protein S1 family (.1)
Lus10011753 86 / 2e-21 AT3G16970 90 / 1e-22 Plant self-incompatibility protein S1 family (.1)
Lus10017929 72 / 5e-17 AT4G16195 71 / 1e-16 Plant self-incompatibility protein S1 family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G148700 96 / 4e-26 AT1G04645 88 / 5e-23 Plant self-incompatibility protein S1 family (.1)
Potri.018G148630 94 / 4e-25 AT1G04645 106 / 3e-30 Plant self-incompatibility protein S1 family (.1)
Potri.018G148366 88 / 3e-23 AT1G04645 103 / 1e-29 Plant self-incompatibility protein S1 family (.1)
Potri.010G008300 79 / 9e-20 AT3G17080 74 / 8e-18 Plant self-incompatibility protein S1 family (.1)
Potri.017G144361 72 / 1e-16 AT4G24975 110 / 1e-31 Plant self-incompatibility protein S1 family (.1)
Potri.003G175200 54 / 7e-10 AT3G24060 177 / 2e-58 Plant self-incompatibility protein S1 family (.1)
Potri.001G053300 48 / 9e-08 AT3G24060 82 / 2e-20 Plant self-incompatibility protein S1 family (.1)
Potri.001G053100 48 / 1e-07 AT3G24060 171 / 2e-55 Plant self-incompatibility protein S1 family (.1)
Potri.016G066900 47 / 4e-07 AT4G29035 85 / 1e-21 Plant self-incompatibility protein S1 family (.1)
Potri.015G130300 46 / 9e-07 AT3G17080 52 / 3e-09 Plant self-incompatibility protein S1 family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05938 Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence
>Lus10030964 pacid=23166811 polypeptide=Lus10030964 locus=Lus10030964.g ID=Lus10030964.BGIv1.0 annot-version=v1.0
ATGGCGACGACGACTAAGACAGCATGGACAATACTGATACTAACAATGGCGTTGATCCAAGCAGTGGACAAGAGCGAAGCCGGAATCATTCATGTGGTGG
GCGTGACGATAACCAACTGGCTGACGGGCAGGCTATACCTGAACCTACATTGTAAGTCGAAAGATGACGACCTAGGCCTAAAGGTAGTACGAAAATGGAG
ATCGTACAGCTGGCATTTCACCCCCAACTTGTGGGGAACAACGCGGTTCTTCTGCGCGTTTAGTTGGGAAGGGAGCGAAAAGTTACATTGGTTCGATATG
TACGTACAGACGAGAGATCAGGATCGTTGTTTCGATTGTAAATGGGTGGTCACTCAGAGGGGGCCTTGCTGGTATAACTCAACCGCCAATTCTTATAATG
TATGTTACGATTGGAATCGGAACTGA
AA sequence
>Lus10030964 pacid=23166811 polypeptide=Lus10030964 locus=Lus10030964.g ID=Lus10030964.BGIv1.0 annot-version=v1.0
MATTTKTAWTILILTMALIQAVDKSEAGIIHVVGVTITNWLTGRLYLNLHCKSKDDDLGLKVVRKWRSYSWHFTPNLWGTTRFFCAFSWEGSEKLHWFDM
YVQTRDQDRCFDCKWVVTQRGPCWYNSTANSYNVCYDWNRN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G12060 Plant self-incompatibility pro... Lus10030964 0 1
Lus10005514 3.7 1.0000
AT1G28300 B3 LEC2 LEAFY COTYLEDON 2, AP2/B3-like... Lus10014005 4.7 1.0000
AT3G02960 Heavy metal transport/detoxifi... Lus10015762 5.7 1.0000
AT5G05070 DHHC-type zinc finger family p... Lus10027274 6.6 1.0000
AT3G60730 Plant invertase/pectin methyle... Lus10015877 8.1 1.0000
AT5G27260 unknown protein Lus10007175 8.4 1.0000
AT1G66350 GRAS RGL1 RGA-like 1 (.1) Lus10016888 8.8 1.0000
AT1G61320 FBD / Leucine Rich Repeat doma... Lus10010664 9.9 1.0000
AT2G36190 ATCWINV4 cell wall invertase 4 (.1) Lus10017015 10.6 1.0000
AT2G04865 Aminotransferase-like, plant m... Lus10014633 11.8 1.0000

Lus10030964 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.