Lus10030965 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G16970 89 / 2e-23 Plant self-incompatibility protein S1 family (.1)
AT5G12070 89 / 4e-23 Plant self-incompatibility protein S1 family (.1)
AT5G12060 87 / 2e-22 Plant self-incompatibility protein S1 family (.1)
AT1G04645 86 / 2e-22 Plant self-incompatibility protein S1 family (.1)
AT3G17080 86 / 4e-22 Plant self-incompatibility protein S1 family (.1)
AT4G16195 79 / 3e-19 Plant self-incompatibility protein S1 family (.1)
AT4G24975 69 / 8e-16 Plant self-incompatibility protein S1 family (.1)
AT3G55252 64 / 1e-13 Plant self-incompatibility protein S1 family (.1)
AT1G26799 64 / 1e-13 Plant self-incompatibility protein S1 family (.1)
AT4G24973 60 / 4e-12 Plant self-incompatibility protein S1 family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030964 239 / 1e-82 AT5G12060 102 / 2e-28 Plant self-incompatibility protein S1 family (.1)
Lus10000480 130 / 2e-40 AT5G12060 84 / 7e-22 Plant self-incompatibility protein S1 family (.1)
Lus10011068 132 / 3e-40 AT4G16195 103 / 5e-29 Plant self-incompatibility protein S1 family (.1)
Lus10008107 110 / 8e-32 AT4G16195 98 / 1e-26 Plant self-incompatibility protein S1 family (.1)
Lus10011069 95 / 2e-25 AT4G16195 89 / 2e-23 Plant self-incompatibility protein S1 family (.1)
Lus10030565 94 / 3e-25 AT3G16970 91 / 7e-24 Plant self-incompatibility protein S1 family (.1)
Lus10013145 93 / 7e-25 AT4G16195 88 / 8e-23 Plant self-incompatibility protein S1 family (.1)
Lus10011753 74 / 6e-17 AT3G16970 90 / 1e-22 Plant self-incompatibility protein S1 family (.1)
Lus10017929 71 / 2e-16 AT4G16195 71 / 1e-16 Plant self-incompatibility protein S1 family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G148700 91 / 8e-24 AT1G04645 88 / 5e-23 Plant self-incompatibility protein S1 family (.1)
Potri.018G148630 87 / 2e-22 AT1G04645 106 / 3e-30 Plant self-incompatibility protein S1 family (.1)
Potri.018G148366 81 / 3e-20 AT1G04645 103 / 1e-29 Plant self-incompatibility protein S1 family (.1)
Potri.010G008300 74 / 8e-18 AT3G17080 74 / 8e-18 Plant self-incompatibility protein S1 family (.1)
Potri.017G144361 71 / 6e-16 AT4G24975 110 / 1e-31 Plant self-incompatibility protein S1 family (.1)
Potri.003G175200 52 / 3e-09 AT3G24060 177 / 2e-58 Plant self-incompatibility protein S1 family (.1)
Potri.001G053100 48 / 1e-07 AT3G24060 171 / 2e-55 Plant self-incompatibility protein S1 family (.1)
Potri.016G066900 45 / 3e-06 AT4G29035 85 / 1e-21 Plant self-incompatibility protein S1 family (.1)
Potri.001G053300 43 / 8e-06 AT3G24060 82 / 2e-20 Plant self-incompatibility protein S1 family (.1)
Potri.015G130300 43 / 9e-06 AT3G17080 52 / 3e-09 Plant self-incompatibility protein S1 family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05938 Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence
>Lus10030965 pacid=23166702 polypeptide=Lus10030965 locus=Lus10030965.g ID=Lus10030965.BGIv1.0 annot-version=v1.0
ATGGCGGCAACAGCTAGGACAGAATGGACAATACTGATACTAACAATGGCGTTGATCCGAGCGGTGGACAAGAGTGAGGCTGGAATCATTCGTGCAGCGG
ACGTGACCATAACCAACTGGCTGACGGGTAGGTTGTATCTGAACATACATTGCAAGTCGAAACAAGACAACATGGGCAAAAAAGTGGTGCGGAAGTGGGG
ATCATACAGCTGGCATTTCACCCCCAACTTGTGGGGAACAACACAGTTCTTCTGCACTTTCAGTTGGGAAGGGAGCGAAGGGGTCCATTGGTTGAATATG
TACGTACAGAATAGGGATCATGATCGATGTTCGGACTGTAAATGGATGGTGACTCAGAGGGGATCTTGTCGGTATAACTCAACCGCTAATTCTTATAATG
TATGTTATAATTGGAATCAGAGCTAA
AA sequence
>Lus10030965 pacid=23166702 polypeptide=Lus10030965 locus=Lus10030965.g ID=Lus10030965.BGIv1.0 annot-version=v1.0
MAATARTEWTILILTMALIRAVDKSEAGIIRAADVTITNWLTGRLYLNIHCKSKQDNMGKKVVRKWGSYSWHFTPNLWGTTQFFCTFSWEGSEGVHWLNM
YVQNRDHDRCSDCKWMVTQRGSCRYNSTANSYNVCYNWNQS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G16970 Plant self-incompatibility pro... Lus10030965 0 1

Lus10030965 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.