Lus10030968 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G32700 276 / 2e-94 PLATZ transcription factor family protein (.1.2)
AT4G17900 272 / 7e-93 PLATZ transcription factor family protein (.1.2)
AT1G21000 215 / 4e-70 PLATZ transcription factor family protein (.1.2)
AT1G76590 209 / 1e-67 PLATZ transcription factor family protein (.1)
AT5G46710 196 / 5e-63 PLATZ transcription factor family protein (.1)
AT1G43000 185 / 9e-59 PLATZ transcription factor family protein (.1)
AT2G27930 160 / 3e-49 PLATZ transcription factor family protein (.1)
AT2G12646 130 / 9e-37 PLATZ transcription factor family protein (.1)
AT3G60670 127 / 6e-36 PLATZ transcription factor family protein (.1)
AT1G31040 120 / 6e-33 PLATZ transcription factor family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040082 393 / 2e-140 AT4G17900 306 / 2e-106 PLATZ transcription factor family protein (.1.2)
Lus10000482 291 / 1e-99 AT4G17900 284 / 2e-97 PLATZ transcription factor family protein (.1.2)
Lus10004577 287 / 2e-98 AT4G17900 287 / 6e-99 PLATZ transcription factor family protein (.1.2)
Lus10020337 264 / 1e-88 AT4G17900 282 / 3e-96 PLATZ transcription factor family protein (.1.2)
Lus10000952 218 / 5e-71 AT1G21000 347 / 5e-122 PLATZ transcription factor family protein (.1.2)
Lus10002700 216 / 8e-70 AT1G21000 345 / 1e-120 PLATZ transcription factor family protein (.1.2)
Lus10027735 198 / 8e-64 AT1G21000 218 / 9e-72 PLATZ transcription factor family protein (.1.2)
Lus10035554 197 / 2e-63 AT1G21000 221 / 4e-73 PLATZ transcription factor family protein (.1.2)
Lus10023411 199 / 1e-62 AT1G21000 313 / 7e-107 PLATZ transcription factor family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G092800 321 / 5e-112 AT4G17900 290 / 5e-100 PLATZ transcription factor family protein (.1.2)
Potri.001G141500 313 / 6e-109 AT4G17900 302 / 5e-105 PLATZ transcription factor family protein (.1.2)
Potri.019G051200 283 / 8e-97 AT4G17900 309 / 2e-107 PLATZ transcription factor family protein (.1.2)
Potri.013G078500 281 / 4e-96 AT4G17900 312 / 1e-108 PLATZ transcription factor family protein (.1.2)
Potri.002G002200 231 / 1e-76 AT1G21000 365 / 2e-129 PLATZ transcription factor family protein (.1.2)
Potri.005G259000 231 / 2e-76 AT1G21000 366 / 1e-129 PLATZ transcription factor family protein (.1.2)
Potri.006G119400 201 / 5e-65 AT2G27930 212 / 3e-70 PLATZ transcription factor family protein (.1)
Potri.016G097100 199 / 3e-64 AT1G32700 200 / 3e-65 PLATZ transcription factor family protein (.1.2)
Potri.009G003200 187 / 1e-59 AT2G27930 227 / 3e-76 PLATZ transcription factor family protein (.1)
Potri.001G212400 184 / 1e-58 AT2G27930 224 / 6e-75 PLATZ transcription factor family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04640 PLATZ PLATZ transcription factor
Representative CDS sequence
>Lus10030968 pacid=23166756 polypeptide=Lus10030968 locus=Lus10030968.g ID=Lus10030968.BGIv1.0 annot-version=v1.0
ATGGGTGCTGGAGGTCCGAACGATGAAGAAAACCACGGCAGGTGGCCGCCATGGTTGAAGCCGCTTCTGAGGGAGAGGTTCTTCGTCCAATGCAAGATAC
ACGCAGATTCACACAAGAGCGAATGCAACATGTACTGCTTGGATTGTATGAACGGCCCACTCTGCTCTCTCTGCCTCTCCTACCACAAGGATCACCGCGC
TATTCAGATAAGGAGATCTTCGTACCACGACGTGATAAGGGTGAACGAGATACAGAAGGTACTGGACATCACTGGCGTCCAGACCTATGTGATTAACAGT
GCTAGAGTTGTGTTCTTGAACGAAAGGCCACAGCCAAGGCCAGGGAAAGGTGTCACCAACACTTGCGAGGTCTGCGAACGAAGCCTGCTCGATTCGTTCC
GATTCTGCTCCCTTGGTTGCAAGATTGCAGGGACATCAGGGAACGTCCAGAAGAGGAGGAAGCAGCAGCAAGTTAAAGATATGGATCATTCATTCTCTGA
TGAATCATATAGCAGTACTACTACTACCCACAGCCATGGGGGACACAATGGACATTACAAGCGCAAGTTATACAACCAGCATCACCATGGAGGGTACATC
AGCAGCAGCATTGATCACAAAATGGAGAGCTTCTCCCCTTCGACACCGCCTCCCACCTCCACGGGCTTCAGGACAGCCAAGAGGAGGAAGGGGATACCTC
ACAGAGCCCCCATGGGAGGACTCATCATAGAATACTAA
AA sequence
>Lus10030968 pacid=23166756 polypeptide=Lus10030968 locus=Lus10030968.g ID=Lus10030968.BGIv1.0 annot-version=v1.0
MGAGGPNDEENHGRWPPWLKPLLRERFFVQCKIHADSHKSECNMYCLDCMNGPLCSLCLSYHKDHRAIQIRRSSYHDVIRVNEIQKVLDITGVQTYVINS
ARVVFLNERPQPRPGKGVTNTCEVCERSLLDSFRFCSLGCKIAGTSGNVQKRRKQQQVKDMDHSFSDESYSSTTTTHSHGGHNGHYKRKLYNQHHHGGYI
SSSIDHKMESFSPSTPPPTSTGFRTAKRRKGIPHRAPMGGLIIEY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G17900 PLATZ transcription factor fam... Lus10030968 0 1
AT1G68300 Adenine nucleotide alpha hydro... Lus10041436 2.0 0.9563
AT3G15290 3-hydroxyacyl-CoA dehydrogenas... Lus10012681 2.0 0.9436
AT5G05140 Transcription elongation facto... Lus10027295 3.2 0.9380
AT1G48300 unknown protein Lus10038034 4.0 0.9495
AT1G68300 Adenine nucleotide alpha hydro... Lus10034337 4.0 0.9346
AT5G24890 unknown protein Lus10009793 7.1 0.9478
AT3G47800 Galactose mutarotase-like supe... Lus10023611 10.1 0.9348
AT5G54680 bHLH bHLH105, ILR3 iaa-leucine resistant3, basic ... Lus10020069 13.0 0.9062
AT4G17900 PLATZ transcription factor fam... Lus10040082 15.4 0.9069
AT1G69490 NAC NAP, ANAC029, A... Arabidopsis NAC domain contain... Lus10037156 16.1 0.9299

Lus10030968 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.