Lus10030984 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G74340 120 / 2e-37 DPMS2, DPMS dolichol phosphate mannose synthase 2, dolichol phosphate-mannose biosynthesis regulatory protein-related (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035381 158 / 2e-52 AT1G74340 120 / 2e-37 dolichol phosphate mannose synthase 2, dolichol phosphate-mannose biosynthesis regulatory protein-related (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G138100 136 / 6e-44 AT1G74340 124 / 3e-39 dolichol phosphate mannose synthase 2, dolichol phosphate-mannose biosynthesis regulatory protein-related (.1)
Potri.003G095701 53 / 6e-11 AT1G74340 37 / 6e-05 dolichol phosphate mannose synthase 2, dolichol phosphate-mannose biosynthesis regulatory protein-related (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF07297 DPM2 Dolichol phosphate-mannose biosynthesis regulatory protein (DPM2)
Representative CDS sequence
>Lus10030984 pacid=23166851 polypeptide=Lus10030984 locus=Lus10030984.g ID=Lus10030984.BGIv1.0 annot-version=v1.0
ATGGAATTAGCAGACAGAGCAGTTGGATTCCTCTTGTCAATAGTCAGCTTATCGATCTTCACATATTATACCTTCTGGGTTATTATCCTGCCGTTCGTAG
ACCATGATCACTTCATTCACCAATATTTCCTGCCACTGGAGTATGCCATATTCATACCCGTATTTGCTGGTGTCGCCCTTGTTTGCTTATTATCTCTCTT
TGTTGGGTCTGTCATGCTCAAATCCAAGAAGAAGAAGGCTTGA
AA sequence
>Lus10030984 pacid=23166851 polypeptide=Lus10030984 locus=Lus10030984.g ID=Lus10030984.BGIv1.0 annot-version=v1.0
MELADRAVGFLLSIVSLSIFTYYTFWVIILPFVDHDHFIHQYFLPLEYAIFIPVFAGVALVCLLSLFVGSVMLKSKKKKA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G74340 DPMS2, DPMS dolichol phosphate mannose syn... Lus10030984 0 1
AT3G47810 ATVPS29, MAG1 VACUOLAR PROTEIN SORTING 29, M... Lus10012851 1.4 0.8045
AT5G07960 unknown protein Lus10034695 11.1 0.7812
AT5G40580 PBB2 20S proteasome beta subunit PB... Lus10014581 18.6 0.7866
AT2G30410 TFCA, KIS TUBULIN FOLDING FACTOR A, tubu... Lus10031896 23.8 0.7637
AT1G76860 Small nuclear ribonucleoprotei... Lus10011293 27.7 0.7587
AT2G32980 unknown protein Lus10030015 33.9 0.7720
AT1G09630 ATRAB-A2A, ATRA... ARABIDOPSIS RAB GTPASE A2A, RA... Lus10041116 39.6 0.7525
AT3G17210 ATHS1 A. THALIANA HEAT STABLE PROTEI... Lus10037823 67.5 0.7345
AT2G27970 CKS2 CDK-subunit 2 (.1) Lus10021405 68.4 0.7355
AT1G06060 LisH and RanBPM domains contai... Lus10004152 97.6 0.6574

Lus10030984 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.