Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G26910 207 / 2e-69 RPL10B ribosomal protein L10 B, Ribosomal protein L16p/L10e family protein (.1) AT1G14320 207 / 2e-69 RPL10A, RPL10, SAC52 SUPPRESSOR OF ACAULIS 52, ribosomal protein L10 A, ribosomal protein L10, Ribosomal protein L16p/L10e family protein (.1.2) AT1G66580 196 / 1e-64 RPL10C, SAG24 ribosomal protein L10 C, senescence associated gene 24 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035401 [exp] 253 / 1e-88 AT1G26910 206 / 5e-69 ribosomal protein L10 B, Ribosomal protein L16p/L10e family protein (.1) Lus10012113 [exp] 240 / 1e-83 AT1G26910 209 / 3e-70 ribosomal protein L10 B, Ribosomal protein L16p/L10e family protein (.1) Lus10010429 [exp] 240 / 1e-83 AT1G26910 209 / 3e-70 ribosomal protein L10 B, Ribosomal protein L16p/L10e family protein (.1) Lus10031568 [exp] 239 / 2e-83 AT1G26910 209 / 5e-70 ribosomal protein L10 B, Ribosomal protein L16p/L10e family protein (.1) Lus10015106 [exp] 239 / 2e-83 AT1G26910 209 / 5e-70 ribosomal protein L10 B, Ribosomal protein L16p/L10e family protein (.1) Lus10034092 [exp] 223 / 8e-77 AT1G26910 216 / 7e-73 ribosomal protein L10 B, Ribosomal protein L16p/L10e family protein (.1) Lus10003055 [exp] 115 / 8e-35 AT1G26910 135 / 2e-41 ribosomal protein L10 B, Ribosomal protein L16p/L10e family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G159600 [exp] 226 / 8e-77 AT1G26910 411 / 3e-148 ribosomal protein L10 B, Ribosomal protein L16p/L10e family protein (.1) Potri.019G131900 [exp] 226 / 1e-76 AT1G26910 410 / 6e-148 ribosomal protein L10 B, Ribosomal protein L16p/L10e family protein (.1) Potri.013G159301 [exp] 135 / 6e-41 AT1G14320 222 / 2e-73 SUPPRESSOR OF ACAULIS 52, ribosomal protein L10 A, ribosomal protein L10, Ribosomal protein L16p/L10e family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00252 [flax] [poplar] Ribosomal_L16 Ribosomal protein L16p/L10e
Representative CDS sequence Show only first row Show all	>Lus10031002 pacid=23166762 polypeptide=Lus10031002 locus=Lus10031002.g ID=Lus10031002.BGIv1.0 annot-version=v1.0 ATGCTTTCGTGTGCTGGAGCTGACAGGCTTCAGACTGGTATGAGGGGTGCCTTCGGTAAGCCCCAAGGTGTCTGTGCCAGGGTTGCTATTGGCCAGGTGC TCCTGTCCGTTCGTTGCAAGGACAGCAACAGTCAGCATGCCCAGGAGGCTCTTCGTCGTGCTAAGTTCAAATTCCCAGGTCGCCAAAAGATTATTGTCAG CAGGAAGTGGGGATTCACTAAGTTTAACCGTGCTGATTACGTTAAACTTAAGCAAGAGAACAGGATTATGTCTGATGGCGTCAATGCTAAGCTTCTCGGA TGTCATGGACCTTTGGCAAACCGTCAGCCTGGAAGAGCTTTTGCTCCTGAAGTTATTGCCGCCACAACATAG
AA sequence Show only first row Show all	>Lus10031002 pacid=23166762 polypeptide=Lus10031002 locus=Lus10031002.g ID=Lus10031002.BGIv1.0 annot-version=v1.0 MLSCAGADRLQTGMRGAFGKPQGVCARVAIGQVLLSVRCKDSNSQHAQEALRRAKFKFPGRQKIIVSRKWGFTKFNRADYVKLKQENRIMSDGVNAKLLG CHGPLANRQPGRAFAPEVIAATT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G26910		RPL10B	ribosomal protein L10 B, Ribos...		Lus10031002 [exp]	0	1
AT1G26910		RPL10B	ribosomal protein L10 B, Ribos...		Lus10035401 [exp]	1.0	0.9608
AT1G77940			Ribosomal protein L7Ae/L30e/S1...		Lus10027926 [exp]	2.4	0.8809
AT3G22630		PRCGB, PBD1	20S proteasome beta subunit D1...		Lus10039351 [exp]	4.1	0.8297
AT3G10950			Zinc-binding ribosomal protein...		Lus10006414 [exp]	6.9	0.8573
AT3G52570			alpha/beta-Hydrolases superfam...		Lus10021315 [exp]	7.5	0.8599
AT1G26880			Ribosomal protein L34e superfa...		Lus10036750 [exp]	8.7	0.8582
AT2G19740			Ribosomal protein L31e family ...		Lus10042028 [exp]	8.7	0.8582
AT1G41880			Ribosomal protein L35Ae family...		Lus10040235 [exp]	9.9	0.8564
AT5G62300			Ribosomal protein S10p/S20e fa...		Lus10038910 [exp]	10.2	0.8380
AT4G18100			Ribosomal protein L32e (.1)		Lus10004589 [exp]	10.2	0.8456

Compare expression of checked genes

Lus10031002 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.