Lus10031026 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042010 71 / 6e-18 ND /
Lus10018015 68 / 1e-16 ND /
Lus10018014 67 / 2e-16 ND /
Lus10042011 66 / 5e-16 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G044300 53 / 5e-11 ND /
Potri.016G041301 50 / 1e-09 ND /
Potri.006G044200 49 / 5e-09 ND /
PFAM info
Representative CDS sequence
>Lus10031026 pacid=23166713 polypeptide=Lus10031026 locus=Lus10031026.g ID=Lus10031026.BGIv1.0 annot-version=v1.0
ATGGCCGGACTGCAGTACAACCTGTTTCCAACCGATTTCTTCTACCCTCGTCCCATCCCCGTTGCAGGCCAGAACTCGACGACCTCCCTTCCAATGTTGC
AGGTCCAGAAGAGAACGGACGGAGCCGCCGATCACCACGATGTGAAGCATCCTAGCAACAGCTTAGTCCTCCTCAACAAAAACTCCGCCACCGTTTCCGC
CGTGGCGAATAAGATGATGATGTAA
AA sequence
>Lus10031026 pacid=23166713 polypeptide=Lus10031026 locus=Lus10031026.g ID=Lus10031026.BGIv1.0 annot-version=v1.0
MAGLQYNLFPTDFFYPRPIPVAGQNSTTSLPMLQVQKRTDGAADHHDVKHPSNSLVLLNKNSATVSAVANKMMM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10031026 0 1
AT1G27040 Major facilitator superfamily ... Lus10006477 1.7 0.9496
AT5G10530 Concanavalin A-like lectin pro... Lus10029555 2.2 0.9363
AT3G47570 Leucine-rich repeat protein ki... Lus10003072 4.7 0.9162
AT2G24560 GDSL-like Lipase/Acylhydrolase... Lus10026405 4.9 0.9324
AT3G47570 Leucine-rich repeat protein ki... Lus10037310 5.3 0.9384
AT2G40200 bHLH bHLH051 basic helix-loop-helix (bHLH) ... Lus10013917 5.5 0.9464
AT3G22600 Bifunctional inhibitor/lipid-t... Lus10010573 6.9 0.9200
AT1G12110 CHL1-1, CHL1, B... CHLORINA 1, ARABIDOPSIS THALIA... Lus10032252 6.9 0.9475
AT3G22600 Bifunctional inhibitor/lipid-t... Lus10039349 11.8 0.9171
AT5G67640 unknown protein Lus10011552 12.4 0.9209

Lus10031026 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.