Lus10031033 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G57270 149 / 8e-44 BG1 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1)
AT5G56590 140 / 4e-39 O-Glycosyl hydrolases family 17 protein (.1)
AT3G57240 131 / 5e-37 BG3 "beta-1,3-glucanase 3", beta-1,3-glucanase 3 (.1)
AT3G57260 124 / 2e-34 AtPR2, PR-2, PR2, BG2, BGL2 PATHOGENESIS-RELATED PROTEIN 2, "beta-1,3-glucanase 2", beta-1,3-glucanase 2 (.1)
AT1G77780 123 / 9e-34 Glycosyl hydrolase superfamily protein (.1)
AT2G01630 119 / 6e-32 O-Glycosyl hydrolases family 17 protein (.1.2)
AT4G16260 115 / 4e-31 Glycosyl hydrolase superfamily protein (.1)
AT2G27500 112 / 6e-30 Glycosyl hydrolase superfamily protein (.1.2.3)
AT1G11820 113 / 8e-30 O-Glycosyl hydrolases family 17 protein (.1.2)
AT5G24318 112 / 2e-29 O-Glycosyl hydrolases family 17 protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035423 342 / 1e-119 AT3G57270 266 / 3e-87 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1)
Lus10031037 209 / 5e-67 AT3G57240 312 / 3e-105 "beta-1,3-glucanase 3", beta-1,3-glucanase 3 (.1)
Lus10031035 196 / 4e-62 AT3G57260 218 / 1e-68 PATHOGENESIS-RELATED PROTEIN 2, "beta-1,3-glucanase 2", beta-1,3-glucanase 2 (.1)
Lus10031036 148 / 4e-44 AT3G57270 210 / 3e-66 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1)
Lus10019800 133 / 9e-39 AT3G57270 238 / 1e-77 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1)
Lus10014110 134 / 2e-38 AT3G57270 359 / 2e-124 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1)
Lus10027479 131 / 1e-37 AT4G16260 216 / 8e-69 Glycosyl hydrolase superfamily protein (.1)
Lus10012937 132 / 2e-36 AT5G56590 617 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Lus10039233 129 / 3e-36 AT4G16260 258 / 5e-84 Glycosyl hydrolase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G172000 142 / 4e-41 AT1G77780 338 / 6e-115 Glycosyl hydrolase superfamily protein (.1)
Potri.002G089200 140 / 2e-40 AT1G77780 309 / 6e-104 Glycosyl hydrolase superfamily protein (.1)
Potri.006G048100 138 / 1e-39 AT3G57270 382 / 6e-133 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1)
Potri.001G255100 136 / 5e-39 AT4G16260 369 / 9e-128 Glycosyl hydrolase superfamily protein (.1)
Potri.016G057400 133 / 7e-38 AT3G57270 416 / 4e-146 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1)
Potri.006G046100 131 / 7e-37 AT3G57270 370 / 4e-128 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1)
Potri.016G057600 128 / 9e-36 AT3G57270 414 / 2e-145 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1)
Potri.018G068600 128 / 9e-35 AT5G56590 685 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Potri.014G184100 119 / 2e-32 AT2G16230 362 / 1e-122 O-Glycosyl hydrolases family 17 protein (.1)
Potri.014G184300 120 / 3e-32 AT2G16230 511 / 1e-179 O-Glycosyl hydrolases family 17 protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0058 Glyco_hydro_tim PF00332 Glyco_hydro_17 Glycosyl hydrolases family 17
Representative CDS sequence
>Lus10031033 pacid=23166871 polypeptide=Lus10031033 locus=Lus10031033.g ID=Lus10031033.BGIv1.0 annot-version=v1.0
ATGCAGAGATCGATCACCGCCATCGGATTAAACTACAGAAAAGTCTCCACTACCATCAGGTACTCACTGAAAAAGTCGTTCCCTCCTTCCAAAGGCGCAT
TCACCGCCGAAGTGGACGTCCTGATGAGACCGTTGGTGAAGGTATTAAAGCGTAACGGAGCGCCGTTGATGGTTAACTCGCACCCTTACTACGGCACACC
GCGTGAGTACGTGTTCTTCGGGGAAGGGTATGAAGGGGTGAAGGACGGAGAGTATAGGTACACGAACATGTTTGACGCTCAGGTGGACGCGATGTACGCG
GCGCTGGAGAGGTACGAGGGCGGCGAGGCGGTGAAGGTGGTGGTGGCGGAGACGGGGTGGCCGACGGCGGGGGATCTTGACGGGATGGCGTCGGTAGAGA
ATGCCAAGGAGTTTAACGGGAATTTGGCGAAGCATGTGAAATTAGGGACGCCGAGGAGGCCCGGGGAGGAGATAGAGACTTACGTTTTTGAGTTGTTTAA
TGAGAATATGAAGACACCCGTTGGGACTGAGAACTGTTGGGGGGTTTTCTATGCCGACATGACTCCGGTTTATCCTATGACTTTCCAGTGA
AA sequence
>Lus10031033 pacid=23166871 polypeptide=Lus10031033 locus=Lus10031033.g ID=Lus10031033.BGIv1.0 annot-version=v1.0
MQRSITAIGLNYRKVSTTIRYSLKKSFPPSKGAFTAEVDVLMRPLVKVLKRNGAPLMVNSHPYYGTPREYVFFGEGYEGVKDGEYRYTNMFDAQVDAMYA
ALERYEGGEAVKVVVAETGWPTAGDLDGMASVENAKEFNGNLAKHVKLGTPRRPGEEIETYVFELFNENMKTPVGTENCWGVFYADMTPVYPMTFQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G57270 BG1 "beta-1,3-glucanase 1", beta-1... Lus10031033 0 1
AT4G28850 ATXTH26, XTH26,... xyloglucan endotransglucosylas... Lus10034957 1.0 1.0000
AT1G70780 unknown protein Lus10039287 1.4 1.0000
Lus10027606 2.4 0.9842
AT3G08710 TRXH9, ATH9 THIOREDOXIN TYPE H 9, thioredo... Lus10012859 2.6 0.9067
AT2G14440 Leucine-rich repeat protein ki... Lus10005049 2.8 0.9713
AT4G37840 HKL3 hexokinase-like 3 (.1) Lus10011584 3.2 0.9279
AT1G71450 AP2_ERF Integrase-type DNA-binding sup... Lus10041050 3.5 0.9262
AT4G39830 Cupredoxin superfamily protein... Lus10000871 3.5 0.8337
AT5G24130 unknown protein Lus10001061 4.0 0.8848
AT1G30710 FAD-binding Berberine family p... Lus10023369 4.2 0.8552

Lus10031033 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.