Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G57260 55 / 1e-10 AtPR2, PR-2, PR2, BG2, BGL2 PATHOGENESIS-RELATED PROTEIN 2, "beta-1,3-glucanase 2", beta-1,3-glucanase 2 (.1) AT3G57240 55 / 2e-10 BG3 "beta-1,3-glucanase 3", beta-1,3-glucanase 3 (.1) AT2G05790 52 / 1e-09 O-Glycosyl hydrolases family 17 protein (.1) AT5G56590 51 / 3e-09 O-Glycosyl hydrolases family 17 protein (.1) AT3G57270 51 / 3e-09 BG1 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1) AT5G20340 50 / 5e-09 BG5 beta-1,3-glucanase 5 (.1) AT5G20330 49 / 2e-08 BETAG4 "beta-1,3-glucanase 4", beta-1,3-glucanase 4 (.1) AT4G18340 48 / 3e-08 Glycosyl hydrolase superfamily protein (.1) AT4G16260 47 / 6e-08 Glycosyl hydrolase superfamily protein (.1) AT1G33220 47 / 1e-07 Glycosyl hydrolase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035423 [exp] 117 / 1e-33 AT3G57270 266 / 3e-87 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1) Lus10031036 [exp] 74 / 1e-17 AT3G57270 210 / 3e-66 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1) Lus10031037 [exp] 69 / 1e-15 AT3G57240 312 / 3e-105 "beta-1,3-glucanase 3", beta-1,3-glucanase 3 (.1) Lus10002807 [exp] 61 / 9e-13 AT3G57240 339 / 7e-116 "beta-1,3-glucanase 3", beta-1,3-glucanase 3 (.1) Lus10031035 [exp] 57 / 2e-11 AT3G57260 218 / 1e-68 PATHOGENESIS-RELATED PROTEIN 2, "beta-1,3-glucanase 2", beta-1,3-glucanase 2 (.1) Lus10014108 [exp] 54 / 4e-10 AT3G57270 366 / 3e-123 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1) Lus10014109 [exp] 52 / 1e-09 AT3G57270 361 / 1e-124 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1) Lus10019801 [exp] 52 / 2e-09 AT3G57270 367 / 6e-127 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1) Lus10020618 [exp] 51 / 3e-09 AT2G27500 494 / 5e-175 Glycosyl hydrolase superfamily protein (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G255100 [exp] 58 / 9e-12 AT4G16260 369 / 9e-128 Glycosyl hydrolase superfamily protein (.1) Potri.006G046100 [exp] 57 / 3e-11 AT3G57270 370 / 4e-128 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1) Potri.009G050401 [exp] 53 / 5e-10 AT4G16260 263 / 2e-87 Glycosyl hydrolase superfamily protein (.1) Potri.010G143166 [exp] 53 / 6e-10 AT4G16260 432 / 5e-153 Glycosyl hydrolase superfamily protein (.1) Potri.010G142800 [exp] 51 / 3e-09 AT4G16260 433 / 2e-152 Glycosyl hydrolase superfamily protein (.1) Potri.014G158400 [exp] 50 / 4e-09 AT2G05790 751 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Potri.006G048100 [exp] 49 / 1e-08 AT3G57270 382 / 6e-133 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1) Potri.018G068600 [exp] 48 / 3e-08 AT5G56590 685 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Potri.016G057400 [exp] 48 / 5e-08 AT3G57270 416 / 4e-146 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1) Potri.016G057600 [exp] 47 / 5e-08 AT3G57270 414 / 2e-145 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0058 [flax] [poplar] Glyco_hydro_tim PF00332 [flax] [poplar] Glyco_hydro_17 Glycosyl hydrolases family 17
Representative CDS sequence Show only first row Show all	>Lus10031034 pacid=23166771 polypeptide=Lus10031034 locus=Lus10031034.g ID=Lus10031034.BGIv1.0 annot-version=v1.0 ATGTTTGTTCTCCTGATGCTTGCTACGGCTCGTCATTTGTACGTAGATGCATCGATCGGTGTGGGTTACGGAGGCAAAGGAGACGACCTACCAACGTCGA TCAAACAAGTAATATCCTTGGTGCAAGAACACAACATCACCCGGATGCGAATCTACGACCCGGACCCGGAAATCCTCCGAGCCATACGAGGAACCAACAT CTAA
AA sequence Show only first row Show all	>Lus10031034 pacid=23166771 polypeptide=Lus10031034 locus=Lus10031034.g ID=Lus10031034.BGIv1.0 annot-version=v1.0 MFVLLMLATARHLYVDASIGVGYGGKGDDLPTSIKQVISLVQEHNITRMRIYDPDPEILRAIRGTNI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G18340			Glycosyl hydrolase superfamily...		Lus10031034 [exp]	0	1
					Lus10000273 [exp]	2.2	1.0000
AT1G17930			Aminotransferase-like, plant m...		Lus10001981 [exp]	3.5	1.0000
AT1G04670			unknown protein		Lus10002298 [exp]	4.2	1.0000
AT4G13420		HAK5, ATHAK5	high affinity K+ transporter 5...		Lus10005194 [exp]	5.3	1.0000
					Lus10027667 [exp]	5.5	1.0000
					Lus10015682 [exp]	6.0	1.0000
					Lus10032828 [exp]	6.3	1.0000
AT5G51030			NAD(P)-binding Rossmann-fold s...		Lus10032524 [exp]	6.5	1.0000
AT3G04120		GAPC1, GAPC-1, ...	glyceraldehyde-3-phosphate deh...		Lus10033306 [exp]	6.7	1.0000
					Lus10019051 [exp]	7.1	1.0000

Compare expression of checked genes

Lus10031034 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.