Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G41520 129 / 2e-35 TPR15 tetratricopeptide repeat 15, Heat shock protein DnaJ with tetratricopeptide repeat (.1.2) AT5G12430 124 / 1e-33 TPR16 tetratricopeptide repeat 16, Heat shock protein DnaJ with tetratricopeptide repeat (.1) AT1G56300 49 / 1e-07 Chaperone DnaJ-domain superfamily protein (.1) AT3G14200 47 / 5e-07 Chaperone DnaJ-domain superfamily protein (.1) AT1G61770 47 / 8e-07 Chaperone DnaJ-domain superfamily protein (.1) AT3G06778 47 / 1e-06 Chaperone DnaJ-domain superfamily protein (.1) AT2G20560 46 / 2e-06 DNAJ heat shock family protein (.1) AT2G41000 45 / 2e-06 Chaperone DnaJ-domain superfamily protein (.1.2) AT2G25560 46 / 3e-06 DNAJ heat shock N-terminal domain-containing protein (.1) AT1G68370 44 / 1e-05 ARG1 ALTERED RESPONSE TO GRAVITY 1, Chaperone DnaJ-domain superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035427 [exp] 240 / 7e-75 AT2G41520 635 / 0.0 tetratricopeptide repeat 15, Heat shock protein DnaJ with tetratricopeptide repeat (.1.2) Lus10005022 [exp] 140 / 3e-39 AT5G12430 791 / 0.0 tetratricopeptide repeat 16, Heat shock protein DnaJ with tetratricopeptide repeat (.1) Lus10019041 [exp] 140 / 4e-39 AT5G12430 787 / 0.0 tetratricopeptide repeat 16, Heat shock protein DnaJ with tetratricopeptide repeat (.1) Lus10020685 [exp] 57 / 2e-10 AT1G56300 200 / 1e-66 Chaperone DnaJ-domain superfamily protein (.1) Lus10029862 [exp] 56 / 3e-10 AT1G56300 201 / 9e-67 Chaperone DnaJ-domain superfamily protein (.1) Lus10002733 [exp] 51 / 3e-08 AT5G22060 299 / 6e-100 ARABIDOPSIS THALIANA DNAJ HOMOLOGUE 2, DNAJ homologue 2 (.1) Lus10008652 [exp] 51 / 4e-08 AT5G22060 300 / 5e-100 ARABIDOPSIS THALIANA DNAJ HOMOLOGUE 2, DNAJ homologue 2 (.1) Lus10013364 [exp] 51 / 6e-08 AT3G44110 291 / 3e-96 DNAJ homologue 3 (.1.2) Lus10021961 [exp] 50 / 1e-07 AT5G25530 468 / 7e-167 DNAJ heat shock family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G047700 [exp] 171 / 6e-50 AT2G41520 640 / 0.0 tetratricopeptide repeat 15, Heat shock protein DnaJ with tetratricopeptide repeat (.1.2) Potri.016G043900 [exp] 162 / 6e-47 AT2G41520 612 / 0.0 tetratricopeptide repeat 15, Heat shock protein DnaJ with tetratricopeptide repeat (.1.2) Potri.009G050200 [exp] 133 / 7e-37 AT5G12430 821 / 0.0 tetratricopeptide repeat 16, Heat shock protein DnaJ with tetratricopeptide repeat (.1) Potri.001G255000 [exp] 125 / 4e-34 AT5G12430 738 / 0.0 tetratricopeptide repeat 16, Heat shock protein DnaJ with tetratricopeptide repeat (.1) Potri.010G243100 [exp] 50 / 6e-08 AT3G44110 528 / 0.0 DNAJ homologue 3 (.1.2) Potri.008G018800 [exp] 50 / 6e-08 AT3G44110 528 / 0.0 DNAJ homologue 3 (.1.2) Potri.010G113400 [exp] 50 / 6e-08 AT1G71000 148 / 2e-45 Chaperone DnaJ-domain superfamily protein (.1) Potri.009G015700 [exp] 50 / 9e-08 AT3G44110 629 / 0.0 DNAJ homologue 3 (.1.2) Potri.013G010800 [exp] 49 / 1e-07 AT1G56300 200 / 9e-67 Chaperone DnaJ-domain superfamily protein (.1) Potri.004G022600 [exp] 48 / 3e-07 AT1G61770 406 / 9e-144 Chaperone DnaJ-domain superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0392 [flax] [poplar] Chaperone-J PF00226 [flax] [poplar] DnaJ DnaJ domain
Representative CDS sequence Show only first row Show all	>Lus10031041 pacid=23166789 polypeptide=Lus10031041 locus=Lus10031041.g ID=Lus10031041.BGIv1.0 annot-version=v1.0 ATGCCTACTCATACTCTACTAATTACTGTAATTCAACAAGTTCATAAGTACTGTCTTGATCATAGGGGTGTCAAAGAATCCGACTCAGCAGCTGATATTA AAAAGGCATACCGTAAGGCAGCATTGAGGCATCATCCTGATAAGGCTGGTCAGTTTCTAGCAAGATCTGAAAGTGGTGATGGGCTGTGGAAGGAAATCGT TGATAAGGTTCACGTTGATGCCGATAAATTGTTCAAAATGATTGGAGAAGCATATGCCGTCCTCTCAGACTCGACAAAGAGATCCAAGTACGATCTTGAA GAGGAAATCCGGAAAGTATCAAAAGAAAACAAAGGGAATAGCTCCAATAGAAGGCCTACTGCTGAGACTAACTACAACTCCCCATTTGGGAGACGACAAG ACAATTGGAAGACGTACGGTCATTCATATTATCGATGGTGA
AA sequence Show only first row Show all	>Lus10031041 pacid=23166789 polypeptide=Lus10031041 locus=Lus10031041.g ID=Lus10031041.BGIv1.0 annot-version=v1.0 MPTHTLLITVIQQVHKYCLDHRGVKESDSAADIKKAYRKAALRHHPDKAGQFLARSESGDGLWKEIVDKVHVDADKLFKMIGEAYAVLSDSTKRSKYDLE EEIRKVSKENKGNSSNRRPTAETNYNSPFGRRQDNWKTYGHSYYRW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G41520		TPR15	tetratricopeptide repeat 15, H...		Lus10031041 [exp]	0	1
AT4G23700		ATCHX17	cation/H+ exchanger 17, cation...		Lus10028747 [exp]	10.6	0.7892
AT5G50340			ATP-dependent peptidases;nucle...		Lus10025843 [exp]	11.5	0.7683
AT5G26770			unknown protein		Lus10031444 [exp]	15.3	0.7742
AT5G51170			unknown protein		Lus10035151 [exp]	22.0	0.7679
AT1G79440		ENF1, SSADH1, A...	SUCCINIC SEMIALDEHYDE DEHYDROG...		Lus10002132 [exp]	28.0	0.6837
AT1G08260		ESD7, EMB142, E...	TILTED 1, EARLY IN SHORT DAYS ...		Lus10006269 [exp]	30.3	0.7409
AT4G14590		EMB2739	embryo defective 2739 (.1)		Lus10032903 [exp]	51.2	0.7097
AT1G10520		AtPol{lambda}	DNA polymerase {lambda}, DNA p...		Lus10030656 [exp]	51.9	0.7533
AT4G16700		PSD1	phosphatidylserine decarboxyla...		Lus10007807 [exp]	67.7	0.7302
AT4G18470		SNI1	SUPPRESSOR OF NPR1-1, INDUCIBL...		Lus10025429 [exp]	68.0	0.7299

Compare expression of checked genes

Lus10031041 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.