Lus10031045 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G35490 223 / 1e-75 MRPL11 mitochondrial ribosomal protein L11 (.1)
AT1G32990 72 / 4e-16 PRPL11 plastid ribosomal protein l11 (.1)
AT5G51610 51 / 3e-08 Ribosomal protein L11 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035432 271 / 8e-95 AT4G35490 272 / 2e-95 mitochondrial ribosomal protein L11 (.1)
Lus10010145 70 / 4e-15 AT1G32990 306 / 7e-107 plastid ribosomal protein l11 (.1)
Lus10017349 70 / 6e-15 AT1G32990 306 / 6e-107 plastid ribosomal protein l11 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G058600 254 / 5e-88 AT4G35490 239 / 2e-82 mitochondrial ribosomal protein L11 (.1)
Potri.011G150700 71 / 2e-15 AT1G32990 303 / 3e-105 plastid ribosomal protein l11 (.1)
Potri.001G450800 70 / 4e-15 AT1G32990 308 / 4e-107 plastid ribosomal protein l11 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
Representative CDS sequence
>Lus10031045 pacid=23166760 polypeptide=Lus10031045 locus=Lus10031045.g ID=Lus10031045.BGIv1.0 annot-version=v1.0
ATGGCGTCGGTGAAGGAAATCCTAACCCGGAGGCCACTCGCCGCGACGATCCGCCTTACAGTCCCTGCGGGAGGAGCTCGTCCGGCACCTCCCGTTGGTC
CGGCGCTTGGTCAGTACCGTCTGAACCTGATGGCGTTCTGCAAGGACTTCAACGCGCGAACTCAGAAGTACAAGCCAGAGACTCCGATGTCGGTGACCAT
TACGGCGTTCAAGGACAACACGTTCGAGTTCACTGTCAAGTCTCCGTCGGTGACTTGGTACTTGAAAAAGGCCGCCGGGATCGAGTCCGCTAGCAGCCGG
CCGGGACACGTGATGGCGTCCACCGTGACGTTGAAGCACGTGTATGAAATTGCCAAGATCAAGCAGTCGGATCCTTACTGCCAGTACATGTCGCTTGGGT
CCATCAGTAGGCCGTTCTTCGGGACGGCCAATACCATGGGGATTAAAGTGGTGAAGGATTTGGAATGA
AA sequence
>Lus10031045 pacid=23166760 polypeptide=Lus10031045 locus=Lus10031045.g ID=Lus10031045.BGIv1.0 annot-version=v1.0
MASVKEILTRRPLAATIRLTVPAGGARPAPPVGPALGQYRLNLMAFCKDFNARTQKYKPETPMSVTITAFKDNTFEFTVKSPSVTWYLKKAAGIESASSR
PGHVMASTVTLKHVYEIAKIKQSDPYCQYMSLGSISRPFFGTANTMGIKVVKDLE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G35490 MRPL11 mitochondrial ribosomal protei... Lus10031045 0 1
AT1G23290 RPL27A, RPL27AB RIBOSOMAL PROTEIN L27A, Riboso... Lus10004617 2.4 0.9636
AT4G35490 MRPL11 mitochondrial ribosomal protei... Lus10035432 2.4 0.9400
AT3G57490 Ribosomal protein S5 family pr... Lus10027358 3.2 0.9679
AT5G40660 ATP12 protein-related (.1) Lus10009910 3.2 0.9331
AT3G09630 Ribosomal protein L4/L1 family... Lus10026476 10.4 0.9500
AT5G10360 RPS6B, EMB3010 Ribosomal protein small subuni... Lus10035414 10.4 0.9488
AT1G29900 VEN3, CARB VENOSA 3, carbamoyl phosphate ... Lus10016137 10.5 0.9327
AT2G04390 Ribosomal S17 family protein (... Lus10004208 11.4 0.9464
AT4G23620 Ribosomal protein L25/Gln-tRNA... Lus10000590 14.3 0.9154
AT1G56070 LOS1, AT1G56075... LOW EXPRESSION OF OSMOTICALLY ... Lus10031186 16.0 0.9298

Lus10031045 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.