Lus10031048 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G43080 406 / 7e-145 AT-P4H-1 P4H isoform 1 (.1)
AT1G20270 230 / 2e-75 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT4G35810 225 / 2e-73 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G66060 223 / 8e-73 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT2G17720 214 / 7e-69 P4H5 prolyl 4-hydroxylase 5, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT3G28480 192 / 3e-60 Oxoglutarate/iron-dependent oxygenase (.1.2)
AT3G28490 189 / 2e-59 Oxoglutarate/iron-dependent oxygenase (.1)
AT3G06300 186 / 5e-58 P4H2, AT-P4H-2 prolyl 4-hydroxylase 2, P4H isoform 2 (.1)
AT5G18900 185 / 1e-57 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT4G35820 159 / 5e-48 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035434 405 / 9e-142 AT2G43080 365 / 4e-125 P4H isoform 1 (.1)
Lus10028404 229 / 5e-75 AT5G66060 486 / 8e-176 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Lus10041857 229 / 6e-75 AT5G66060 488 / 2e-176 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Lus10032183 205 / 4e-65 AT3G28480 434 / 3e-154 Oxoglutarate/iron-dependent oxygenase (.1.2)
Lus10005620 203 / 3e-64 AT1G20270 465 / 7e-167 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10012014 193 / 1e-60 AT5G18900 448 / 2e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10016271 192 / 2e-60 AT5G18900 444 / 2e-158 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10014502 187 / 1e-58 AT3G28480 398 / 4e-140 Oxoglutarate/iron-dependent oxygenase (.1.2)
Lus10017249 189 / 3e-58 AT1G20270 455 / 3e-162 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G232100 401 / 1e-142 AT2G43080 456 / 4e-164 P4H isoform 1 (.1)
Potri.005G108000 228 / 2e-74 AT5G66060 405 / 1e-143 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.005G245300 214 / 6e-69 AT1G20270 483 / 3e-174 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.007G060800 211 / 1e-67 AT5G66060 349 / 6e-121 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.008G197700 201 / 1e-63 AT5G18900 448 / 3e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.017G075100 194 / 5e-61 AT3G28480 436 / 3e-155 Oxoglutarate/iron-dependent oxygenase (.1.2)
Potri.017G075300 192 / 1e-60 AT3G28480 345 / 5e-120 Oxoglutarate/iron-dependent oxygenase (.1.2)
Potri.007G052600 163 / 5e-49 AT4G33910 353 / 4e-123 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G296800 151 / 9e-45 AT4G33910 441 / 6e-158 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.009G091000 149 / 7e-44 AT4G33910 431 / 9e-154 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence
>Lus10031048 pacid=23166839 polypeptide=Lus10031048 locus=Lus10031048.g ID=Lus10031048.BGIv1.0 annot-version=v1.0
ATGTCCCCTACGCAGCTTATAAAAAAAATCCCCTGCGCATCTTTTTTTCCAGGAATTCCTGACTGGAACAATGATAAAGAAGCAGAGAGTCTGAGGATTG
GACATGTCAAACCAGAAGTTATCAGCTGGTCACCGAGAATCATCGTATTGCACAATTTTTTGAGCACGGAGGAATGTGACTATCTTAGGGCCTTAGCTCG
ACCTCGCCTTCAGGTTTCAACTGTCGTGGATGCAAAAACAGGAAAGGGAATAAAGAGTAATGTTAGAACAAGCTCTGGAATGTTTCTAAGCTCGGCCGAG
AGAAGGTACCCTTTGGTAAAGGCTATTGAGAAAAGGATCGCCGTGTATTCTCAAGTTCCTTCGGAGAATGGTGAGCTTATCCAAGTATTAAGGTATGAGA
AGGAACAGTTTTACAAGCCTCATCATGACTACTTCTCTGATACTTTTAACATTCAACGTGGCGGCCAGCGAGTAGCAACGATGTTGATGTACTTGAGCGA
CAATGTCGAGGGTGGAGAAACTTATTTCCCTCTGGCAGGATCAGGCCAGTGTACTTGCGGTGGGGAGGTAATGAAAGGCTTGTCCGTAAAGCCAGTTAAA
GGAGACGCGGTTCTCTTTTGGAGCATGGGTTTAGATGGTGAATCGGATCCGAAGAGCATACATGGAGGATGCAAGATTCTCTCCGGAGAGAAATGGTCAG
CTACAAAATGGATGAGGCAAAAATCTGCCAGCTAA
AA sequence
>Lus10031048 pacid=23166839 polypeptide=Lus10031048 locus=Lus10031048.g ID=Lus10031048.BGIv1.0 annot-version=v1.0
MSPTQLIKKIPCASFFPGIPDWNNDKEAESLRIGHVKPEVISWSPRIIVLHNFLSTEECDYLRALARPRLQVSTVVDAKTGKGIKSNVRTSSGMFLSSAE
RRYPLVKAIEKRIAVYSQVPSENGELIQVLRYEKEQFYKPHHDYFSDTFNIQRGGQRVATMLMYLSDNVEGGETYFPLAGSGQCTCGGEVMKGLSVKPVK
GDAVLFWSMGLDGESDPKSIHGGCKILSGEKWSATKWMRQKSAS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G43080 AT-P4H-1 P4H isoform 1 (.1) Lus10031048 0 1
AT4G05000 VPS28-2, VPS28-... vacuolar protein sorting-assoc... Lus10018442 1.0 0.8811
AT3G46020 RNA-binding (RRM/RBD/RNP motif... Lus10040854 6.3 0.8775
AT4G30360 ATCNGC17 cyclic nucleotide-gated channe... Lus10023203 8.1 0.8797
AT3G09890 Ankyrin repeat family protein ... Lus10014410 8.5 0.8536
AT3G60540 Preprotein translocase Sec, Se... Lus10010009 10.1 0.8791
AT5G26250 Major facilitator superfamily ... Lus10005870 11.8 0.8053
AT5G04850 VPS60.2 SNF7 family protein (.1.2) Lus10028867 21.9 0.8342
AT3G15352 ATCOX17 ARABIDOPSIS THALIANA CYTOCHROM... Lus10035780 26.1 0.8373
AT3G24490 Trihelix Alcohol dehydrogenase transcri... Lus10019388 30.1 0.8699
AT1G34750 Protein phosphatase 2C family ... Lus10033453 30.2 0.8487

Lus10031048 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.