Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G10330 110 / 5e-31 Cyclin-like family protein (.1) AT2G41630 102 / 3e-28 TFIIB transcription factor IIB (.1) AT3G29380 73 / 5e-17 pBRP2 plant-specific TFIIB-related protein 2, Cyclin-like family protein (.1) AT5G39230 51 / 7e-10 TFIIB zinc-binding protein (.1) AT4G10680 47 / 9e-08 transcription factor IIB (TFIIB) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035440 [exp] 113 / 6e-32 AT3G10330 603 / 0.0 Cyclin-like family protein (.1) Lus10016260 [exp] 91 / 9e-24 AT3G10330 499 / 5e-180 Cyclin-like family protein (.1) Lus10029285 [exp] 60 / 9e-14 AT3G10330 71 / 3e-16 Cyclin-like family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G057100 [exp] 108 / 2e-30 AT3G10330 611 / 0.0 Cyclin-like family protein (.1) Potri.006G048400 [exp] 100 / 2e-27 AT3G10330 605 / 0.0 Cyclin-like family protein (.1) Potri.015G067500 [exp] 99 / 9e-27 AT3G10330 499 / 5e-180 Cyclin-like family protein (.1) Potri.017G093100 [exp] 70 / 5e-16 AT3G10330 333 / 1e-114 Cyclin-like family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [flax] [poplar] Zn_Beta_Ribbon PF08271 [flax] [poplar] TF_Zn_Ribbon TFIIB zinc-binding
Representative CDS sequence Show only first row Show all	>Lus10031056 pacid=23166775 polypeptide=Lus10031056 locus=Lus10031056.g ID=Lus10031056.BGIv1.0 annot-version=v1.0 ATGTCGGATGCTTACTGCTCGGACTGCAAGCGCCAGACGGAGGTGGTGTTCGATCACTCGGCGGGGGACACCGTCTGCTCTGAGTGCGGCCTTGTCCTCG AGTCTCACTCCATCGACGAGACCTCCGAGTGGAGGACTTTCGCCAACGAGTCTGGCGTGGGGAAGCAGACCCCATCGGTGTCGGACGTCCCCCAACCCCG CTCCTGCCCGACGGCGGCTTGTCCACCGTGA
AA sequence Show only first row Show all	>Lus10031056 pacid=23166775 polypeptide=Lus10031056 locus=Lus10031056.g ID=Lus10031056.BGIv1.0 annot-version=v1.0 MSDAYCSDCKRQTEVVFDHSAGDTVCSECGLVLESHSIDETSEWRTFANESGVGKQTPSVSDVPQPRSCPTAACPP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G10330			Cyclin-like family protein (.1...		Lus10031056 [exp]	0	1
AT1G26560		BGLU40	beta glucosidase 40 (.1)		Lus10037098 [exp]	4.9	0.6769
AT3G55770	LIM	WLIM2b	WLIM2b, GATA type zinc finger ...		Lus10028257 [exp]	8.9	0.6724
AT3G48490			unknown protein		Lus10014788 [exp]	9.9	0.6628
AT2G37470			Histone superfamily protein (....		Lus10006484 [exp]	10.1	0.6720
AT4G34660			SH3 domain-containing protein ...		Lus10017501 [exp]	16.2	0.6737
AT3G59350			Protein kinase superfamily pro...		Lus10026708 [exp]	21.1	0.6770
AT5G65670	AUX_IAA	IAA9	indole-3-acetic acid inducible...		Lus10011583 [exp]	22.4	0.6692
AT2G42590		GENERALREGULATO...	general regulatory factor 9 (....		Lus10017652 [exp]	37.9	0.6691
AT2G44600			unknown protein		Lus10043351 [exp]	39.0	0.6532
AT5G15880			unknown protein		Lus10034091 [exp]	40.8	0.6535

Compare expression of checked genes

Lus10031056 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.