Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G05400 76 / 1e-17 copper ion binding (.1.2) AT4G21140 59 / 1e-11 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027072 [exp] 144 / 2e-44 AT4G05400 282 / 2e-96 copper ion binding (.1.2) Lus10008331 [exp] 138 / 1e-41 AT4G05400 269 / 5e-91 copper ion binding (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G098000 [exp] 103 / 3e-28 AT4G05400 273 / 6e-93 copper ion binding (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10031070 pacid=23166803 polypeptide=Lus10031070 locus=Lus10031070.g ID=Lus10031070.BGIv1.0 annot-version=v1.0 ATGTTCCGGGTCGTGAGAGCAAAACCACTCAAATCTCTGACGCACCAATTCATCCAGCAATGTTTCGTCAGTGGGACTGCAAAAGGGAAAGCGAAATTGA AAGACGGACCAAAGAAGAAGATGAAGGTCTCCACCAAGAAGGGCGGGAAGGGTGCCGTTGATCTAGATCCTTCCGCCCGGCCAACTTCTCGTCAAGACGC GGAGAAGTACAAGCTCTACGATCAGTGCATAAACGCGCCCACTCCAGTTCGATACCTGAAGCCCAAGGAGATGAAACGGGAGGAGGAGAGGCAGAAGCTA GGGTTGGAAAGCAAAGAGCGGCAGCGGGAGAAAGAGTATTGA
AA sequence Show only first row Show all	>Lus10031070 pacid=23166803 polypeptide=Lus10031070 locus=Lus10031070.g ID=Lus10031070.BGIv1.0 annot-version=v1.0 MFRVVRAKPLKSLTHQFIQQCFVSGTAKGKAKLKDGPKKKMKVSTKKGGKGAVDLDPSARPTSRQDAEKYKLYDQCINAPTPVRYLKPKEMKREEERQKL GLESKERQREKEY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G05400			copper ion binding (.1.2)		Lus10031070 [exp]	0	1
AT1G75030		ATLP-3	thaumatin-like protein 3 (.1)		Lus10015705 [exp]	3.3	0.7992
					Lus10013622 [exp]	5.7	0.7649
AT2G15220			Plant basic secretory protein ...		Lus10014106 [exp]	6.5	0.7517
AT5G17820			Peroxidase superfamily protein...		Lus10020311 [exp]	6.7	0.7493
AT5G47430			DWNN domain, a CCHC-type zinc ...		Lus10029205 [exp]	8.1	0.7556
AT1G49170			Protein of unknown function (D...		Lus10042819 [exp]	9.9	0.7733
AT5G16080		ATCXE17	carboxyesterase 17 (.1)		Lus10033548 [exp]	12.0	0.7610
					Lus10022051 [exp]	12.3	0.7277
AT3G49070			Protein of unknown function (D...		Lus10027501 [exp]	17.4	0.7303
AT3G51710			D-mannose binding lectin prote...		Lus10009088 [exp]	20.3	0.7277

Compare expression of checked genes

Lus10031070 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.