Lus10031071 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G57450 69 / 6e-17 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035455 123 / 1e-38 AT3G57450 69 / 3e-17 unknown protein
Lus10018070 73 / 2e-18 AT3G57450 66 / 1e-15 unknown protein
Lus10042063 72 / 1e-17 AT3G57450 67 / 1e-15 unknown protein
Lus10029496 68 / 1e-16 AT3G57450 64 / 6e-15 unknown protein
Lus10019730 63 / 1e-14 AT3G57450 66 / 8e-16 unknown protein
Lus10016391 62 / 2e-14 AT3G57450 66 / 1e-15 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G055901 79 / 4e-21 AT3G57450 70 / 2e-17 unknown protein
Potri.006G050800 71 / 7e-18 AT3G57450 59 / 4e-13 unknown protein
Potri.001G263404 68 / 6e-17 AT3G57450 64 / 3e-15 unknown protein
Potri.012G032500 64 / 3e-15 AT3G57450 66 / 2e-15 unknown protein
Potri.009G058500 56 / 4e-12 AT3G57450 47 / 1e-08 unknown protein
PFAM info
Representative CDS sequence
>Lus10031071 pacid=23166864 polypeptide=Lus10031071 locus=Lus10031071.g ID=Lus10031071.BGIv1.0 annot-version=v1.0
ATGGGGAAGTACATGGAGCTGTTGGACGCAAGCGTGAGGATCGCCGGAAGATTCTACTCCCACTGCCCGCAGACTGCTAGGCTCTACTACCATCCTCCTT
CAAATAATTCCGATCAGTTCCACGATCTCGCCAACGGCGGCGGTTGCTGCAAGAGTACTGCCCAGAGAGATCATGAACCGGCCTCCAAACTGGCCGGGTT
TGGTGTTGATTCTGCTGATCAGTTGGTGTATTACTCTGTTTTCTGA
AA sequence
>Lus10031071 pacid=23166864 polypeptide=Lus10031071 locus=Lus10031071.g ID=Lus10031071.BGIv1.0 annot-version=v1.0
MGKYMELLDASVRIAGRFYSHCPQTARLYYHPPSNNSDQFHDLANGGGCCKSTAQRDHEPASKLAGFGVDSADQLVYYSVF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G57450 unknown protein Lus10031071 0 1
AT3G57450 unknown protein Lus10035455 1.7 0.9217
AT4G29780 unknown protein Lus10011946 4.1 0.9314
AT2G40000 ATHSPRO2 ARABIDOPSIS ORTHOLOG OF SUGAR ... Lus10040215 6.3 0.8957
AT5G39865 Glutaredoxin family protein (.... Lus10017335 6.5 0.9033
AT1G06450 Polynucleotidyl transferase, r... Lus10035078 7.7 0.9227
AT1G07160 Protein phosphatase 2C family ... Lus10042275 8.7 0.9201
AT1G51200 A20/AN1-like zinc finger famil... Lus10004889 9.5 0.8901
AT5G01710 methyltransferases (.1) Lus10022682 10.7 0.8863
AT1G74450 Protein of unknown function (D... Lus10042809 10.8 0.8959
AT4G00300 fringe-related protein (.1.2) Lus10005120 11.2 0.9083

Lus10031071 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.