Plant FIBer expression Database

Lus10031075 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G17930 44 / 3e-06 Aminotransferase-like, plant mobile domain family protein (.1)
AT1G48120 39 / 0.0002 hydrolases;protein serine/threonine phosphatases (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024780
[exp]
163 / 1e-53 ND 40 / 2e-04
Lus10005495
[exp]
166 / 2e-53 AT1G17930 54 / 2e-08 Aminotransferase-like, plant mobile domain family protein (.1)
Lus10004830
[exp]
162 / 1e-51 AT1G17930 48 / 4e-06 Aminotransferase-like, plant mobile domain family protein (.1)
Lus10022091
[exp]
170 / 1e-50 AT3G23070 860 / 0.0 CRM family member 3A (.1)
Lus10039393
[exp]
159 / 4e-50 AT1G17930 73 / 3e-14 Aminotransferase-like, plant mobile domain family protein (.1)
Lus10008249
[exp]
154 / 3e-49 ND 40 / 3e-04
Lus10005957
[exp]
155 / 8e-48 AT1G48120 75 / 1e-14 hydrolases;protein serine/threonine phosphatases (.1)
Lus10032987
[exp]
144 / 2e-46 ND 34 / 0.008
Lus10024503
[exp]
140 / 8e-45 ND 36 / 0.002
Poplar homologues

No hit found
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF10536 PMD Plant mobile domain
Representative CDS sequence
>Lus10031075 pacid=23166806 polypeptide=Lus10031075 locus=Lus10031075.g ID=Lus10031075.BGIv1.0 annot-version=v1.0
ATGCACGATTGTCTGGAGTACTACCGTCGTCCGCTTGATGATATGACCGCACGGGATGTGATCTGGCTGCCATTTGGGCCACATCCCGAGGTAGAGGTTC
CCAATTCGACATTTCGTGGGGTGATTCGTTTCGGTCCGACAGCAGAGTACTATGATCCGATACGTGTGGTTAGACAGTTCGGCTACGCGCAGATTATTCC
GGGTCTTATCCCTGTGCCTTCGAGGGCATATAGGGCGGCTGAGCCTAATGGGTACACAGTTGAGTGGGCTGACAGCACAGATAGAGCTTGA
AA sequence
>Lus10031075 pacid=23166806 polypeptide=Lus10031075 locus=Lus10031075.g ID=Lus10031075.BGIv1.0 annot-version=v1.0
MHDCLEYYRRPLDDMTARDVIWLPFGPHPEVEVPNSTFRGVIRFGPTAEYYDPIRVVRQFGYAQIIPGLIPVPSRAYRAAEPNGYTVEWADSTDRA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G17930 Aminotransferase-like, plant m... Lus10031075
[exp]
0 1
Lus10002332
[exp]
2.4 1.0000
AT1G02335 GL22 germin-like protein subfamily ... Lus10004856
[exp]
3.5 1.0000
AT2G43870 Pectin lyase-like superfamily ... Lus10011417
[exp]
4.2 1.0000
AT3G05950 RmlC-like cupins superfamily p... Lus10023351
[exp]
4.9 1.0000
AT3G53710 AGD6 ARF-GAP domain 6 (.1.2) Lus10012991
[exp]
5.5 1.0000
AT3G19270 CYP707A4 "cytochrome P450, family 707, ... Lus10014056
[exp]
6.0 1.0000
AT5G23960 ATTPS21 terpene synthase 21 (.1.2) Lus10033189
[exp]
7.0 1.0000
AT2G24100 ASG1 ALTERED SEED GERMINATION 1, un... Lus10029847
[exp]
7.3 0.8786
AT2G28630 KCS12 3-ketoacyl-CoA synthase 12 (.1... Lus10033628
[exp]
7.5 1.0000
AT4G35500 Protein kinase superfamily pro... Lus10035984
[exp]
7.5 0.9586

Lus10031075 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.