Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G21237 57 / 5e-11 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10031077 pacid=23166823 polypeptide=Lus10031077 locus=Lus10031077.g ID=Lus10031077.BGIv1.0 annot-version=v1.0 ATGAACCCATCATCAAACTGCAAGACAAAGCTCTCAACTTTTGCAGCAAACGCGAAAGCTCCCTTTTTCGCCTTGGACTTCCCAAACCCGAATATCATCG CTGTCTACATATTAAGCAGCTTCTTTACTTTCTTCCTGGGAATCGCCATGGTCTTTGAATGGGCTTTCCATGGCCGTCGCTACCCTGGATGTCAATGGAC AATCTTCTATGCGGTTTCGCTCATTCTACTTCCCCTCCTCTGCCTCTTGCTCTGCTTTCTCTCTAACAGAATCATCCGTCCCCGCCGCATCCCTCCCCCA ACTCTGACAATTACTCCAACCCAGCAGCAAGAGATGGAATCTGTCTCGATTGAAGGAGCATAG
AA sequence Show only first row Show all	>Lus10031077 pacid=23166823 polypeptide=Lus10031077 locus=Lus10031077.g ID=Lus10031077.BGIv1.0 annot-version=v1.0 MNPSSNCKTKLSTFAANAKAPFFALDFPNPNIIAVYILSSFFTFFLGIAMVFEWAFHGRRYPGCQWTIFYAVSLILLPLLCLLLCFLSNRIIRPRRIPPP TLTITPTQQQEMESVSIEGA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G21237			unknown protein		Lus10031077 [exp]	0	1
AT5G48030		GFA2	gametophytic factor 2 (.1)		Lus10011934 [exp]	3.6	0.8310
AT1G54870			NAD(P)-binding Rossmann-fold s...		Lus10029937 [exp]	7.3	0.7128
AT1G69800			Cystathionine beta-synthase (C...		Lus10013265 [exp]	8.1	0.8136
AT5G59700			Protein kinase superfamily pro...		Lus10020474 [exp]	9.4	0.7842
AT2G31730	bHLH		basic helix-loop-helix (bHLH) ...		Lus10024071 [exp]	10.0	0.8209
AT2G28100		ATFUC1	alpha-L-fucosidase 1 (.1)		Lus10027390 [exp]	10.5	0.7791
AT2G44290			Bifunctional inhibitor/lipid-t...		Lus10017749 [exp]	13.4	0.8129
AT5G23260	MADS	ABS, TT16, AGL3...	TRANSPARENT TESTA16, AGAMOUS-l...		Lus10017388 [exp]	17.0	0.7645
AT1G74830			Protein of unknown function, D...		Lus10036656 [exp]	17.3	0.7799
AT3G11570		TBL8	TRICHOME BIREFRINGENCE-LIKE 8 ...		Lus10000250 [exp]	17.3	0.7918

Compare expression of checked genes

Lus10031077 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.