Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G34700 147 / 3e-47 CIB22, AtCIB22 B22 subunit of eukaryotic mitochondrial Complex I, LYR family of Fe/S cluster biogenesis protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035469 [exp] 181 / 1e-59 AT4G34700 176 / 2e-57 B22 subunit of eukaryotic mitochondrial Complex I, LYR family of Fe/S cluster biogenesis protein (.1) Lus10018052 [exp] 172 / 6e-56 AT4G34700 179 / 5e-58 B22 subunit of eukaryotic mitochondrial Complex I, LYR family of Fe/S cluster biogenesis protein (.1) Lus10042049 [exp] 166 / 1e-54 AT4G34700 195 / 4e-66 B22 subunit of eukaryotic mitochondrial Complex I, LYR family of Fe/S cluster biogenesis protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G124600 [exp] 164 / 7e-54 AT4G34700 171 / 9e-57 B22 subunit of eukaryotic mitochondrial Complex I, LYR family of Fe/S cluster biogenesis protein (.1) Potri.004G163000 [exp] 164 / 8e-54 AT4G34700 174 / 1e-57 B22 subunit of eukaryotic mitochondrial Complex I, LYR family of Fe/S cluster biogenesis protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10031084 pacid=23166704 polypeptide=Lus10031084 locus=Lus10031084.g ID=Lus10031084.BGIv1.0 annot-version=v1.0 ATGAGTGTGGCGTCAACGGCGGCGTACGCTGCCCGGCGGGCAGCGCAGAAGCAACAGGTTCGGATCCTGTACCGCAGGGCTCTCAAGGATACTCTGAACT GGGCAGTCCACCGTCACCTCTTTTACGAAGATGCGGACAATCTTCGTGCGAAGTTTGAGGTGAACAAGGGAGTGGAAGATCCTGATACAATTGACAGGCT CATTGCTGATGGTGAGGGTCAATATAACAAGTGGAGACATCCTGATCCTTACATTGTTCCATGGGCACCTGGTGGATCTAAGTTCACTAGAAACCCAACT CCACCTGAAGGGGCTGCTTGA
AA sequence Show only first row Show all	>Lus10031084 pacid=23166704 polypeptide=Lus10031084 locus=Lus10031084.g ID=Lus10031084.BGIv1.0 annot-version=v1.0 MSVASTAAYAARRAAQKQQVRILYRRALKDTLNWAVHRHLFYEDADNLRAKFEVNKGVEDPDTIDRLIADGEGQYNKWRHPDPYIVPWAPGGSKFTRNPT PPEGAA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G34700		CIB22, AtCIB22	B22 subunit of eukaryotic mito...		Lus10031084 [exp]	0	1
AT5G25450			Cytochrome bd ubiquinol oxidas...		Lus10008081 [exp]	3.2	0.8401
AT1G48440			B-cell receptor-associated 31-...		Lus10040126 [exp]	5.3	0.8111
AT1G48440			B-cell receptor-associated 31-...		Lus10001080 [exp]	5.3	0.8348
AT1G70590			F-box family protein (.1)		Lus10004621 [exp]	7.5	0.7724
AT3G22590		PHP, CDC73	PLANT HOMOLOGOUS TO PARAFIBROM...		Lus10021913 [exp]	10.6	0.7581
AT1G23750			Nucleic acid-binding, OB-fold-...		Lus10030871 [exp]	10.7	0.7889
AT5G54750			Transport protein particle (TR...		Lus10028720 [exp]	11.2	0.7877
AT5G25450			Cytochrome bd ubiquinol oxidas...		Lus10013113 [exp]	11.2	0.8125
AT4G20280		TAF11	TBP-associated factor 11 (.1)		Lus10036241 [exp]	11.2	0.7425
AT3G10860			Cytochrome b-c1 complex, subun...		Lus10034442 [exp]	13.4	0.7671

Compare expression of checked genes

Lus10031084 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.