Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G39010 50 / 2e-08 ATGH9B18 glycosyl hydrolase 9B18 (.1) AT4G38990 46 / 5e-07 ATGH9B16 glycosyl hydrolase 9B16 (.1) AT4G02290 45 / 2e-06 ATGH9B13 glycosyl hydrolase 9B13 (.1) AT1G23210 45 / 2e-06 ATGH9B6 glycosyl hydrolase 9B6 (.1) AT4G11050 44 / 2e-06 ATGH9C3 glycosyl hydrolase 9C3 (.1) AT1G70710 44 / 3e-06 CEL1 ,AtGH9B1 CELLULASE 1, glycosyl hydrolase 9B1 (.1) AT1G02800 43 / 9e-06 ATCEL2 cellulase 2 (.1) AT1G22880 42 / 2e-05 ATCEL5 ,ATGH9B4 ARABIDOPSIS THALIANA GLYCOSYL HYDROLASE 9B4, ARABIDOPSIS THALIANA CELLULASE 5, cellulase 5 (.1.2) AT1G64390 42 / 2e-05 ATGH9C2 glycosyl hydrolase 9C2 (.1) AT4G09740 42 / 2e-05 ATGH9B14 glycosyl hydrolase 9B14 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001666 [exp] 47 / 5e-07 AT1G02800 600 / 0.0 cellulase 2 (.1) Lus10017338 [exp] 45 / 1e-06 AT1G02800 390 / 1e-130 cellulase 2 (.1) Lus10033957 [exp] 45 / 3e-06 AT1G64390 797 / 0.0 glycosyl hydrolase 9C2 (.1) Lus10029071 [exp] 44 / 3e-06 AT1G70710 827 / 0.0 CELLULASE 1, glycosyl hydrolase 9B1 (.1) Lus10025880 [exp] 44 / 4e-06 AT1G71380 646 / 0.0 ARABIDOPSIS THALIANA GLYCOSYL HYDROLASE 9B3, cellulase 3 (.1) Lus10010307 [exp] 44 / 5e-06 AT4G02290 493 / 2e-171 glycosyl hydrolase 9B13 (.1) Lus10008208 [exp] 44 / 5e-06 AT4G02290 812 / 0.0 glycosyl hydrolase 9B13 (.1) Lus10032377 [exp] 44 / 5e-06 AT1G64390 989 / 0.0 glycosyl hydrolase 9C2 (.1) Lus10003888 [exp] 44 / 6e-06 AT1G64390 960 / 0.0 glycosyl hydrolase 9C2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G162200 [exp] 50 / 2e-08 AT4G39010 703 / 0.0 glycosyl hydrolase 9B18 (.1) Potri.009G123900 [exp] 50 / 2e-08 AT4G39010 722 / 0.0 glycosyl hydrolase 9B18 (.1) Potri.001G083200 [exp] 46 / 7e-07 AT1G02800 593 / 0.0 cellulase 2 (.1) Potri.001G098800 [exp] 45 / 1e-06 AT4G09740 669 / 0.0 glycosyl hydrolase 9B14 (.1) Potri.001G092200 [exp] 45 / 2e-06 AT1G64390 951 / 0.0 glycosyl hydrolase 9C2 (.1) Potri.003G139600 [exp] 44 / 3e-06 AT1G64390 999 / 0.0 glycosyl hydrolase 9C2 (.1) Potri.008G132700 [exp] 44 / 6e-06 AT1G70710 808 / 0.0 CELLULASE 1, glycosyl hydrolase 9B1 (.1) Potri.010G109200 [exp] 43 / 6e-06 AT1G70710 829 / 0.0 CELLULASE 1, glycosyl hydrolase 9B1 (.1) Potri.015G128000 [exp] 43 / 1e-05 AT1G70710 569 / 0.0 CELLULASE 1, glycosyl hydrolase 9B1 (.1) Potri.002G202400 [exp] 42 / 1e-05 AT4G02290 818 / 0.0 glycosyl hydrolase 9B13 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0059 [flax] [poplar] 6_Hairpin PF00759 [flax] [poplar] Glyco_hydro_9 Glycosyl hydrolase family 9
Representative CDS sequence Show only first row Show all	>Lus10031091 pacid=23166872 polypeptide=Lus10031091 locus=Lus10031091.g ID=Lus10031091.BGIv1.0 annot-version=v1.0 ATGAAGACTCTCTCCTCCTTCATCCTCCTCCTCCTCATGATCTTCCTTCTACATTCCGCCTCCGCCTCCCACGACTACTCCGACGCCCTCTCCAAATCCA TCCTCTTCTTCGAGGGCCAGCGCTCCGGCTACCTCCCGCAGGACCAGCGCCTCTCGTGGCGGGGGCGACACAGCGGCGGGCGAACTCCGGCCTCTCCGAC GGCTGGACCTACAACTTCGACCTTGCCGGCGGGTACTACGACGCCGGCGACAACGTCAAGTTCGGCTTCCCTCTCGCCTTCACCACCACCATGCTCGCCT GGAGTGTGA
AA sequence Show only first row Show all	>Lus10031091 pacid=23166872 polypeptide=Lus10031091 locus=Lus10031091.g ID=Lus10031091.BGIv1.0 annot-version=v1.0 MKTLSSFILLLLMIFLLHSASASHDYSDALSKSILFFEGQRSGYLPQDQRLSWRGRHSGGRTPASPTAGPTTSTLPAGTTTPATTSSSASLSPSPPPCSP GV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G39010		ATGH9B18	glycosyl hydrolase 9B18 (.1)		Lus10031091 [exp]	0	1
AT4G39010		ATGH9B18	glycosyl hydrolase 9B18 (.1)		Lus10031090 [exp]	3.2	0.8477
AT4G14368			Regulator of chromosome conden...		Lus10030999 [exp]	28.5	0.8105
AT4G38130		ATHDA19, ATHD1,...	ARABIDOPSIS HISTONE DEACETYLAS...		Lus10001356 [exp]	32.6	0.8039
AT1G67040			unknown protein		Lus10017607 [exp]	55.8	0.7946
AT1G68480	C2H2ZnF	JAG	JAGGED, C2H2 and C2HC zinc fin...		Lus10034329 [exp]	81.4	0.7764
AT5G65590	DOF	AtDof5,7	Dof-type zinc finger DNA-bindi...		Lus10035955 [exp]	89.0	0.7749
AT5G28237			Pyridoxal-5'-phosphate-depende...		Lus10018358 [exp]	89.0	0.7679
AT3G22790			Kinase interacting (KIP1-like)...		Lus10006606 [exp]	91.7	0.7782
AT4G36920	AP2_ERF	FL1, FLO2, AP2	FLORAL MUTANT 2, FLOWER 1, APE...		Lus10023165 [exp]	102.4	0.7664
AT3G18010	HD	WOX1	WUSCHEL related homeobox 1 (.1...		Lus10042007 [exp]	114.7	0.7658

Compare expression of checked genes

Lus10031091 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.