Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G52605 45 / 2e-07 Defensin-like (DEFL) family protein (.1) AT4G14276 45 / 3e-07 Defensin-like (DEFL) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033170 [exp] 128 / 6e-40 AT5G52605 49 / 7e-09 Defensin-like (DEFL) family protein (.1) Lus10013114 [exp] 118 / 3e-36 AT5G52605 45 / 2e-07 Defensin-like (DEFL) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G113600 [exp] 56 / 7e-12 AT5G52605 76 / 8e-20 Defensin-like (DEFL) family protein (.1) Potri.013G113550 [exp] 56 / 1e-11 AT5G52605 67 / 3e-16 Defensin-like (DEFL) family protein (.1) Potri.016G130300 [exp] 54 / 4e-11 AT5G52605 64 / 3e-15 Defensin-like (DEFL) family protein (.1) Potri.005G074350 [exp] 53 / 1e-10 AT4G14276 66 / 1e-15 Defensin-like (DEFL) family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10031095 pacid=23166797 polypeptide=Lus10031095 locus=Lus10031095.g ID=Lus10031095.BGIv1.0 annot-version=v1.0 ATGGGTGGAAGAGGAGTAGTGAAAGTACTTGTATGCATGGTGTTGCTGGTTTTGATGGGTGAAGCCGAATGCAGCAGAGGTATTGACATCAGCAGCAGCA TGACCATGGTGGCCGAGGCCGCTGGTTTGGTCCAGCCGATGGGGATATGTTGCAGGGAGCATTACGATAAGGGACCGTGCGAGCCAGGTGTCGGAGACGT TCCGGGAGGCAAGTGCTACGATTTCTGTATAGCAGAGTGTAAGGGCGCACTCTGCAAGAAGACTTCCAAGGGACACCACTGCCATTGTTTGTGCTAG
AA sequence Show only first row Show all	>Lus10031095 pacid=23166797 polypeptide=Lus10031095 locus=Lus10031095.g ID=Lus10031095.BGIv1.0 annot-version=v1.0 MGGRGVVKVLVCMVLLVLMGEAECSRGIDISSSMTMVAEAAGLVQPMGICCREHYDKGPCEPGVGDVPGGKCYDFCIAECKGALCKKTSKGHHCHCLC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G52605			Defensin-like (DEFL) family pr...		Lus10031095 [exp]	0	1
AT1G21000			PLATZ transcription factor fam...		Lus10005350 [exp]	1.0	1.0000
AT5G56670			Ribosomal protein S30 family p...		Lus10019054 [exp]	2.0	1.0000
					Lus10035508 [exp]	2.4	1.0000
					Lus10012269 [exp]	3.2	1.0000
AT5G04347			Plant self-incompatibility pro...		Lus10029375 [exp]	3.5	1.0000
AT5G48540			receptor-like protein kinase-r...		Lus10030777 [exp]	3.7	1.0000
AT4G15530		PPDK	pyruvate orthophosphate dikina...		Lus10006147 [exp]	4.0	0.9974
					Lus10000882 [exp]	4.2	0.9894
AT3G18040		ATMPK9	MAP kinase 9 (.1.2)		Lus10038956 [exp]	4.5	1.0000
AT5G06570			alpha/beta-Hydrolases superfam...		Lus10015989 [exp]	4.7	0.7435

Compare expression of checked genes

Lus10031095 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.